(data stored in ACNUC7421 zone)

EMBL: CP001349.PE7

CP001349.PE7         Location/Qualifiers
FT   CDS_pept        10128..12341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0008"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number="6.3.5.3"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   II; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: met:M446_0005
FT                   phosphoribosylformylglycinamidine synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55059"
FT                   /db_xref="GOA:B8ISZ7"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ7"
FT                   /inference="protein motif:TFAM:TIGR01736"
FT                   /protein_id="ACL55059.1"
FT                   /translation="MIRNDIAITPELVRQHGLTEEEYARFKGLIGREPTITELGIVSAM
FT                   WNEHCSYKSSRIHLRTLPTSAPWVIQGPGENAGVIDIGDGLACVFKMESHNHPSFIEPY
FT                   QGAATGVGGILRDVFTMGARPIAALNALRFGSPDHPRTRHLVAGVVAGIGGYGNSFGVP
FT                   TVGGSVGFHRRYDGNILVNAMAVGLARADAIFYAAATGVGNPIVYLGSKTGRDGIHGAT
FT                   MASAAFDESSEEKRPTVQVGDPFAEKLLLEACLELMASGAVIAIQDMGAAGLTCSAVEM
FT                   GAKGNLGVELNLDAVPTREPGMTAYEMMLSESQERMLMVLKPGMEEQAKAIFVKWGLDF
FT                   AIIGHTTDTLRFVIKHGGETVADLPIKELGDEAPVYDRPHRSNLYHPVLGPEEVPAPVT
FT                   NVDALRRLVGSPDLASKRWVWEQYDHFILGNTVQKPGGDAAVVRVEDGPKGLALTTDVT
FT                   PRYCEADPVEGGRQAVAEAYRNISAVGGRPLAVTDNLNFGNPERPEVMGQFVGCIHGIG
FT                   EACRALDFPVVSGNVSLYNETNGVGILPTPTIGGVGVVDDVRKTATIAFKREGDALVLI
FT                   GRTEGWLGQSLYLAEICGREEGAPPPVDLAAERRNGEFVRGLIASGLVDTVHDLSDGGL
FT                   AVALAEMAMAGGIGAALPECPLPVPCHAYLFGEDQGRYLLAVDPETLPDLLYSASAQGI
FT                   DAAVIGVTGADSLTLPGDETISVEELRGVHEAWLPNYMAGPAA"
     atgatccgca acgacatcgc catcacgccc gaactggtgc gccagcacgg cctcaccgag        60
     gaggaatacg cccgcttcaa gggactgatc gggcgggagc cgaccatcac ggagctcggc       120
     atcgtctcgg cgatgtggaa cgagcactgc tcctacaagt cctcgcgcat ccacctgcgg       180
     acgctgccga ccagcgcgcc ctgggtgatc cagggcccgg gcgagaatgc gggcgtcatc       240
     gacatcggcg acggcctcgc ctgcgtgttc aagatggaga gccacaacca cccgagcttc       300
     atcgagccct accagggcgc ggcgacgggg gtgggcggca tcctgcgcga cgtgttcacc       360
     atgggcgcgc ggccgatcgc ggcgctgaac gcgctccgct tcggctcccc cgaccatccc       420
     cgcacccgcc acctcgtggc gggcgtcgtc gcgggcatcg gcggctacgg caattccttc       480
     ggcgtgccga ccgtcggcgg ctcggtcggc ttccaccggc gctacgacgg caacatcctg       540
     gtcaacgcca tggcggtcgg gctcgcgcgg gccgatgcga tcttctatgc ggcggcgacc       600
     ggcgtcggga acccgatcgt ctatctgggc tccaaaaccg ggcgcgacgg catccacggc       660
     gccaccatgg cctcggccgc cttcgacgaa tcctccgagg agaagcgccc gaccgtgcag       720
     gtgggcgatc ccttcgcgga aaaactcctc ctcgaagcct gcctggagct gatggcctcg       780
     ggcgccgtca tcgcgatcca ggacatgggc gcggcgggcc tcacctgctc ggcagtggag       840
     atgggcgcca agggcaatct cggggtggag ctgaacctcg acgcggtccc gacccgcgag       900
     cccggcatga ccgcctacga gatgatgctc tccgagagcc aggagcgcat gctcatggtg       960
     ctcaagccgg gcatggagga gcaggcgaag gccatcttcg tgaagtgggg cctcgatttc      1020
     gcgatcatcg gccacaccac cgacacgctg cgcttcgtca tcaagcatgg cggcgagacc      1080
     gtcgcggacc tgcccatcaa ggaactcggc gacgaggccc cggtctacga ccggccgcac      1140
     cgctcgaacc tgtaccaccc ggtgctcggg cctgaggagg tgccggcgcc ggtgacgaac      1200
     gtggacgcgc tgcgcaggct cgtcggctcg cccgacctcg cctcgaagcg ctgggtctgg      1260
     gagcagtacg accacttcat cctcggcaac accgtgcaga agcccggggg cgacgccgcc      1320
     gtggtgcggg tcgaggacgg gccgaagggg cttgcgctca ccaccgacgt gaccccccgc      1380
     tactgcgagg ccgatccggt cgagggcggc cggcaggccg tggcagaggc ctaccgcaac      1440
     atcagcgcgg tcggcggccg gccgctcgcc gtgaccgaca acctcaactt cggcaacccg      1500
     gagaggccgg aggtgatggg tcagttcgtc ggctgcatcc acggcatcgg tgaggcctgc      1560
     cgcgccctcg acttcccggt cgtctcgggc aacgtctccc tctacaacga gaccaacggc      1620
     gtcggcatcc tgccgacccc gaccatcggc ggcgtcggcg tcgtcgacga cgtgaggaag      1680
     accgccacca tcgcgttcaa gcgcgagggc gacgcgctgg tgctgatcgg ccgcaccgag      1740
     ggctggctcg gccagtccct ctacctcgcc gagatctgcg gccgcgagga gggcgccccg      1800
     cccccggtcg atctcgcagc cgagcgccgc aacggcgagt tcgtgcgcgg gctcatcgcc      1860
     tcgggtctcg tcgacacggt gcatgacctc tcggatggcg gcctcgccgt ggcgctcgcc      1920
     gagatggcga tggccggcgg catcggcgcc gccctgcccg agtgccccct gccggtcccc      1980
     tgccacgcct acctgttcgg cgaggaccag ggccgctatc tccttgcggt cgatcccgag      2040
     acccttcccg acctcctcta cagcgcctcc gcgcagggca tcgacgcggc ggtgatcggc      2100
     gtcacggggg cggattcgtt gaccctgccg ggcgacgaga ccatatcggt ggaggagctg      2160
     cgcggcgtcc acgaggcgtg gctgccgaac tatatggccg gccccgccgc ctga            2214
//

If you have problems or comments...

PBIL Back to PBIL home page