(data stored in ACNUC7421 zone)

EMBL: CP001349.PE70

CP001349.PE70        Location/Qualifiers
FT   CDS_pept        complement(77203..77832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0072"
FT                   /product="phosphonate metabolim protein, transferase
FT                   hexapeptide repeat family"
FT                   /note="TIGRFAM: phosphonate metabolim protein, transferase
FT                   hexapeptide repeat family; KEGG: atc:AGR_C_2119
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55122"
FT                   /db_xref="GOA:B8IU77"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR017694"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU77"
FT                   /inference="protein motif:TFAM:TIGR03308"
FT                   /protein_id="ACL55122.1"
FT                   /translation="MNDATRAPKIARTIVDETTSIRETSLGACCEILARCSIEYASIGD
FT                   YSYIGHDSIVADAEIGKFCAIAAHVRIGAPNHPIERPSLHRFTYCPEYYDAGAKRDHAF
FT                   FLRRREDRVHIGHDVWIGHGVIVLPGVRVGTGAVLAAGAVVTRDVAPYAVVAGVPARRI
FT                   RERFPPDIAERLQRIAWWDWPFSRIMEHIRDFQSDDIGRFCETWDR"
     atgaacgacg cgacgcgcgc acccaagatc gcccggacga tcgtcgatga gacgacgtcc        60
     attcgggaga ccagcttagg ggcctgctgc gagattctcg cccgctgttc gatcgaatat       120
     gcgtcgatcg gcgattacag ctatatcggc cacgactcga tcgtcgccga tgccgagatc       180
     ggcaaattct gcgccatcgc cgcgcatgtg cgcatcggcg ctcccaatca tccgatcgag       240
     cgtccctcgc tgcatcggtt cacctattgc ccggaatact acgatgcggg cgccaagcgc       300
     gaccacgcct tcttcctccg ccgccgcgaa gaccgggttc atatcggcca tgacgtctgg       360
     atcgggcatg gggtgatcgt gctgccgggg gtccgggtcg gcaccggcgc ggttttggcc       420
     gccggcgcgg tggtgaccag ggatgtcgcg ccctatgcgg tcgtcgccgg cgttccggcg       480
     cgccggattc gggaacgctt cccacccgat attgcggagc gcttgcagcg catcgcctgg       540
     tgggattggc cgttctcccg aatcatggag cacatccgtg atttccagtc ggacgatatc       600
     ggccgcttct gcgagacatg ggatcgttga                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page