(data stored in ACNUC7421 zone)

EMBL: CP001349.PE71

CP001349.PE71        Location/Qualifiers
FT   CDS_pept        complement(78352..78738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0073"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   met:M446_6212 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55123"
FT                   /db_xref="GOA:B8IU78"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU78"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACL55123.1"
FT                   /translation="MGQAIFSRGIALVVEDDPHLRDLAAALLEETDLRVVEAASGEEAL
FT                   DYLRERADEVAFVFADVRLPNLVDGVDLARMIALKWPWIRMVVTSGAAGDRIDYLPRSA
FT                   TYMPKPWRALDVLVAAEQAIARNS"
     atgggacagg cgattttttc acgcggaata gccctggtgg tcgaggacga cccccacctg        60
     cgcgacctgg ctgcggccct cctcgaagag accgatctgc gcgtggtcga ggcggcgagc       120
     ggcgaagagg ctctggacta cctgcgggaa cgcgccgacg aggtggcctt cgtgttcgcc       180
     gacgtgcgcc ttcccaacct cgtcgacggt gtggacctcg cgcgcatgat cgcgctcaag       240
     tggccgtgga tccggatggt ggtgacctcc ggcgcggccg gcgaccggat cgattacttg       300
     ccccgctcgg cgacctatat gccgaagccg tggagggcgc tcgacgtgct ggtggctgcc       360
     gagcaggcca tagcccgcaa cagctga                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page