(data stored in ACNUC7421 zone)

EMBL: CP001349.PE72

CP001349.PE72        Location/Qualifiers
FT   CDS_pept        complement(79282..80016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_6153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55124"
FT                   /db_xref="GOA:B8IU79"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU79"
FT                   /inference="similar to AA sequence:KEGG:M446_6153"
FT                   /protein_id="ACL55124.1"
FT                   /translation="MIRDEQIEIPVDHRRIAGTMVRPTIAAPGILFVHGWAGNQDQYLS
FT                   RARGIAALGCVCLTFDLHGHAETESDQDKVTREDNLRDIVAAYDKLAGQADVDAGAIGV
FT                   IGSSYGGYLAAILTSLRPVRWLGLRVPALYKDHDWTVPKQQLNKRELAIYRRGPVCADE
FT                   NRALGACANFRGDVLIVESEFDDVVPHPVIVNYRDAFDRARSVTYRVIAGADHALSEPP
FT                   WQEAYTSLLVNWAEELIIGARE"
     atgatacggg atgagcaaat cgaaataccg gtcgaccatc ggcggatcgc cggcactatg        60
     gtccgcccga cgatcgcagc gcccggcatc ctgttcgtgc atggctgggc cggcaaccag       120
     gatcaatatc tgtcacgcgc gcgcggaatc gcggcgctcg gctgcgtctg cctcaccttc       180
     gaccttcatg ggcatgcaga aaccgaatcc gatcaggaca aggttacacg tgaagataat       240
     ctgagggata tcgttgccgc ctacgacaag ctcgctggcc aagccgatgt ggatgcgggt       300
     gcgatcggtg tgatcggcag cagctacggc ggctatcttg cggcgatact gacctcgctg       360
     aggcccgtcc gctggctcgg attgcgggtg cctgccctct acaaggatca cgactggacc       420
     gtaccgaaac aacagctcaa caaaagggag ctggcgatct accgacgcgg tcccgtctgt       480
     gccgatgaga atcgggcact gggagcctgc gcaaattttc ggggcgatgt gctcatcgtc       540
     gaatccgagt tcgacgatgt cgtgccgcat cccgtcatcg tcaattatcg cgacgcattc       600
     gatcgggctc gatccgtcac ctaccgggtc atcgcgggag ccgatcacgc cttgtccgag       660
     ccgccctggc aagaagccta tacttccctt ctcgtgaact gggcagaaga actcatcatc       720
     ggcgcgagag aatga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page