(data stored in ACNUC7421 zone)

EMBL: CP001349.PE73

CP001349.PE73        Location/Qualifiers
FT   CDS_pept        complement(80003..81148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0075"
FT                   /product="biotin carboxylase"
FT                   /note="KEGG: met:M446_6154 biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55125"
FT                   /db_xref="InterPro:IPR021519"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU80"
FT                   /inference="similar to AA sequence:KEGG:M446_6154"
FT                   /protein_id="ACL55125.1"
FT                   /translation="MPQQARPHLHQPAPNGVVVVLTAADGGLSSLHERMTRTEIAKRLA
FT                   GLMNFEFGGEYDAGTRYPGRLYFVPSRTLVGLETAQSLGIRGEQDLFGGVVPHAFVATK
FT                   AITQPLVTPDACAPPGWNRAFGDAVQNLVLAGFSVFTREDARRAAETLLRCGRVRLKPV
FT                   LATGGRGQVLLSDLAELETALEAVDPDELSSCGLVLEENLTGTTTYSVGQVRSCNLLVT
FT                   YYGTQRVTTDNSGREVYGGSTLVVVRDGFEALLALDIPKLARIAIRQAQAYDSAAWAHF
FT                   PGLLVSRRNYDVIQGLDARGRWRSGVLEQSWRLGGASAAEIAALEAFAGDPGLRVVRAS
FT                   CVEIYGDSKDPPTDSITLFRGVDDEVGFISKYAMVDLHDTG"
     atgccgcagc aagcacgacc tcatctgcat cagccggcgc cgaacggcgt cgtcgtcgtc        60
     ctcacggccg ccgacggcgg gctctcctcg cttcacgaaa ggatgacacg aaccgagatc       120
     gcaaagcggc tcgccgggct catgaatttc gagttcgggg gagagtatga tgcagggacg       180
     cgctatcccg ggcggctcta ttttgttccg agccggacgc tcgtcggcct cgagacggcg       240
     caaagcctcg gaatacgcgg tgagcaggat ctgttcggag gcgtggtgcc gcacgctttc       300
     gtggccacga aagccatcac ccagccgctc gtgaccccgg atgcatgcgc gccgccggga       360
     tggaaccgcg cattcggcga cgccgtgcag aacctcgttc tcgccgggtt ctcggtgttc       420
     acgcgggagg atgctcgccg ggcagccgag accctcctgc gatgcgggag agtgcggctc       480
     aagccggttc ttgccaccgg tgggcgcggg caggtgctgc tctcggatct cgccgaactg       540
     gagaccgcgc tcgaagccgt cgaccctgac gagctctcca gctgcggcct cgtcctcgaa       600
     gaaaacctga ccggcacgac gacctacagc gttggtcagg tgcgaagctg caacctcctg       660
     gtgacctatt acgggacgca gcgcgtcacc acggacaaca gcgggcgtga ggtctatggc       720
     ggctcgaccc tggtggtcgt ccgcgacggg ttcgaggccc tgctcgccct cgatatcccg       780
     aagctcgcgc ggatcgccat tcggcaggcg caggcctatg acagcgccgc atgggcgcat       840
     ttcccgggcc tgctcgtctc ccggaggaac tacgatgtga ttcaggggct tgatgcacga       900
     ggacgctggc gttccggcgt cctggaacaa tcctggcgct tgggcggcgc gagcgctgcg       960
     gaaattgccg cgctggaagc attcgccggt gatccgggcc ttcgggtcgt gcgcgcgtcc      1020
     tgtgtcgaga tctacggaga cagtaaagat ccgcccaccg attcgatcac cttgttccgc      1080
     ggtgttgatg atgaggtggg cttcatttcg aaatatgcaa tggttgacct ccatgatacg      1140
     ggatga                                                                 1146
//

If you have problems or comments...

PBIL Back to PBIL home page