(data stored in ACNUC7421 zone)

EMBL: CP001349.PE74

CP001349.PE74        Location/Qualifiers
FT   CDS_pept        complement(81266..81772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc01448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55126"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="InterPro:IPR038282"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU81"
FT                   /inference="similar to AA sequence:KEGG:SMc01448"
FT                   /protein_id="ACL55126.1"
FT                   /translation="MSATGLAVFDKTLQITHIWLDELMAELGPDREVAWHVLGVVLRRI
FT                   RDRVPLELAAHLGAQLPLLVRGHYYDQWRPGHQPERSRSLDEFLDGIAAGLANTRPVNV
FT                   QAASQAVFGVLSRHVDRGQVDKVRAALPEEVRLLWPHEPDAPGISILEDEPGATPYPSV
FT                   GADRG"
     atgagtgcga caggtctcgc cgtcttcgac aagacccttc agatcaccca tatctggctc        60
     gacgagctga tggcggaact cggtcccgac cgcgaagtcg catggcacgt cctcggggtc       120
     gtcctgcgcc gaatccgtga ccgcgtaccg ctcgagcttg ccgcccatct cggcgctcaa       180
     ctgccacttc tggtgcgtgg acactactat gaccagtggc gaccgggtca tcagccggaa       240
     cggtcgcgca gcctcgacga gttcctggac ggcatcgcgg caggcctggc gaatacgcga       300
     ccggtgaacg tgcaggccgc gtcgcaggcg gtgttcggcg tgctctcgcg ccatgtggac       360
     cgcggccagg tcgacaaggt tcgcgcggcg ctgcccgagg aggtccgcct cctctggccc       420
     catgagccgg atgcgcccgg catctcgatc ctcgaagacg agcctggcgc gacgccgtat       480
     ccttcggtcg gagcagaccg aggctga                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page