(data stored in ACNUC7421 zone)

EMBL: CP001349.PE75

CP001349.PE75        Location/Qualifiers
FT   CDS_pept        complement(82001..82246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55127"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU82"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55127.1"
FT                   /translation="MQLSELACEILEIFRQNHRRPGARLTFGYLRERLGSEPTLTAAAS
FT                   ELTDAGYVIAPDADTIELTARGFDTLQRENYGSTTG"
     atgcagctga gtgagctggc ctgtgagatc cttgagatct tccgtcagaa tcatcgccgg        60
     ccgggggcga gactgacctt tggctacttg agggagcggc tgggctccga gccgacgctc       120
     accgcggcgg cgtccgagct cacggatgcc ggatacgtca tcgcccctga cgcggacacg       180
     atcgaactca ccgcacgggg cttcgatacg ctccagcgcg agaattatgg gagcacgaca       240
     ggatag                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page