(data stored in ACNUC7421 zone)

EMBL: CP001349.PE76

CP001349.PE76        Location/Qualifiers
FT   CDS_pept        complement(83111..84526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0078"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   KEGG: rle:pRL120502 putative guanylate/adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55128"
FT                   /db_xref="GOA:B8IU83"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU83"
FT                   /inference="protein motif:PFAM:PF00211"
FT                   /protein_id="ACL55128.1"
FT                   /translation="MMHDSDALLDALRQAGDPEAVQALEQLIQHGADEELVRINALSFA
FT                   GEHGLSQDAVISTLLHGARLGLFEMSWNILCSSCGGVLGANASLKSVRQDAYRCAFCAL
FT                   DTEPILDDAVEVSFAISPRIRRVAAHDPGSLAFWDYHRQIFFGTGVVFPEPPAFEDLAR
FT                   LATLEAVELQAGERMILALQIPAGSLILFDPVTHTAQVLDVAGEPAQQRQELSLVFDDI
FT                   RPAVGHVDLKPGQLRLTLENRSEERVLPGIFIAGEALNTLIGGRRPFLTAKRLLSNQAF
FT                   RDIYRTDALDVDQRLKILSLTFVFTDLTGSTDLYERVGDLVAYDLVRSHFQILTAVVAS
FT                   HGGAVVKTIGDAVMATFPMPSQAVAAALEMREAMRRLNTGRETDELILKIGLHEGPCLA
FT                   VLLNDRQDYFGQTVNIAARVQELATSGAIFVSEPVVRHAEAARLLTEKGLQAQRHLCSL
FT                   RGIGSRMPVFELT"
     atgatgcacg acagcgacgc tctcctcgac gcccttcgtc aagcgggcga ccccgaagcg        60
     gtgcaggcgc tggagcagct gatccagcac ggtgccgatg aggaactcgt ccgcatcaac       120
     gcgctgagct ttgcaggcga acacggcttg agccaggacg cggtgatcag cacgctcctg       180
     cacggcgccc ggctcggtct gttcgagatg tcctggaata tcctctgctc cagctgtgga       240
     ggcgtgctcg gtgcgaatgc cagcctgaaa agcgtgcggc aggacgccta tcgctgcgcc       300
     ttctgcgctc tcgacacgga gccgatcctc gacgatgccg tcgaggtcag cttcgcgatc       360
     agtccgcgca ttcggcgcgt cgccgcgcac gatccgggca gtctcgcctt ctgggactac       420
     catcggcaga tcttcttcgg cacgggggtg gtcttccctg agccgcccgc attcgaggac       480
     ctcgcgcgat tggcgacgct cgaagccgtc gagctgcagg ccggcgagag gatgatcctg       540
     gcgctgcaga ttccggccgg gtccctgatc ctgttcgatc cggtcactca taccgcgcag       600
     gttctcgacg ttgctggcga accggctcag cagcgtcagg agctcagcct cgtgttcgat       660
     gacatcaggc ccgccgtcgg ccatgtcgac ctgaaaccgg gccaacttcg cctcacgttg       720
     gagaaccgca gcgaagaacg cgtgctgccc ggcatcttca tcgccggcga ggcgctgaac       780
     acgctgatcg ggggccgtcg gcccttcctc accgcgaagc gccttttgag caatcaagct       840
     ttccgcgaca tctatcggac cgacgctctc gatgtcgatc agcggctcaa gatcctgagc       900
     ttgaccttcg tgttcaccga cctgaccggc tcaacggatc tctacgaacg ggtcggcgat       960
     ctcgtcgcct acgacctggt gcgctcgcat ttccagatcc tcacggcggt ggtggcttct      1020
     cacggcggag ccgtcgtcaa gaccatcggc gatgccgtga tggcgacctt tccgatgccg      1080
     agccaagccg tcgcggctgc cctcgagatg cgagaggcca tgcgtcgtct gaacacaggt      1140
     cgcgagacgg acgagctgat cctcaagatc gggcttcatg agggaccctg ccttgctgtc      1200
     cttctgaacg accggcagga ctacttcgga cagacggtca acattgcggc gcgcgtgcag      1260
     gagctcgcca cctccggcgc catcttcgtc agcgagccgg tcgtccggca tgcggaggca      1320
     gcccgcctgc tcacggagaa ggggcttcag gcacagcggc acctttgcag tttgcgtggg      1380
     atcggcagtc gcatgcccgt cttcgagctg acttag                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page