(data stored in ACNUC7421 zone)

EMBL: CP001349.PE77

CP001349.PE77        Location/Qualifiers
FT   CDS_pept        85171..86010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0079"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   met:M446_2090 GDSL family lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55129"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU84"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ACL55129.1"
FT                   /translation="MTRDGHRSSVSSQPRPASGWRRIARSLALLVSLSTSSTMVLAYAD
FT                   LLPQVMEQEILASPAGGLPHLTRRLAQQGAPLRIVAFGSSSTEGVGASSPAAAYPARLE
FT                   AALRRALPRLAGGITVLNRGIGGEHADDMLGRLERDVLAARPDLVIWQTGSNDPLRGVS
FT                   LEHFREATVAGVRRMQAAGSDVVLMEPQWCPKLDATPDAYRFRDMVREIGAELGVPVIR
FT                   RSDLMRDWIAGGRLTREELFAPDGLHMADRGYDLLGQAVARDILRRAQPVVMAQAGE"
     atgacgcgcg acggccatcg gtcctcggtc agttctcagc cacgtccggc cagtggctgg        60
     cggcggatcg cacgcagcct ggcgctgctc gtcagcctca gcacctcctc gacgatggtc       120
     ctggcctatg cggatctgct gccgcaggtc atggagcagg agattcttgc ctcaccggcc       180
     ggagggttgc cgcacctcac ccggcggctc gcgcagcagg gcgctcctct gcggatcgtc       240
     gccttcggct cctcgtcgac cgaaggcgtc ggcgccagtt ccccggcggc cgcctatccg       300
     gcccggctgg aggccgctct caggcgtgcc cttccgcgcc tcgcgggcgg catcacggtg       360
     ctcaaccgcg gcatcggcgg cgagcacgcg gacgacatgc tcgggcggct ggagcgcgac       420
     gtgctcgccg ccaggcccga cctcgtgatc tggcagacgg gcagcaacga cccgctgcgg       480
     ggcgtctccc tggagcattt ccgcgaggcg acggtggcgg gtgtgcgacg gatgcaggct       540
     gcaggcagcg acgtcgtgct gatggagccg caatggtgcc cgaagctcga tgcgacgccg       600
     gacgcttatc ggttccggga catggtgcgg gagatcgggg ccgagctcgg cgttccggtg       660
     atccgccgct cggacctgat gcgggactgg atcgccggcg ggaggctcac gcgcgaagag       720
     ctgttcgcgc ccgacggctt gcacatggcc gaccgcggct acgacctgct cgggcaggcc       780
     gttgctcgcg acatcctgcg ccgggcccag cccgtggtga tggcgcaagc gggcgagtga       840
//

If you have problems or comments...

PBIL Back to PBIL home page