(data stored in ACNUC7421 zone)

EMBL: CP001349.PE78

CP001349.PE78        Location/Qualifiers
FT   CDS_pept        complement(86372..86647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_6371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55130"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU85"
FT                   /inference="similar to AA sequence:KEGG:M446_6371"
FT                   /protein_id="ACL55130.1"
FT                   /translation="MPRYYFDVLSRSGLVCQDFQGLECRDDAAALAVARHGAGFTSHDD
FT                   CARNPQLTHYLFSVADAAHRPLFTVPFTELEPDQSQAPRRRRGAAH"
     atgccgcgtt actatttcga cgtgctgtcc cggtccggcc tcgtttgcca agatttccag        60
     gggctggagt gtcgcgacga cgcggcggcc cttgctgtcg ctcgccatgg cgccgggttc       120
     acgtcgcatg acgattgtgc ccgtaatccg cagctcaccc actacctgtt ttcagtggct       180
     gatgcggcgc accgaccctt gttcacggtc ccgttcacgg agcttgagcc ggaccaatca       240
     caggcaccgc gccgacgccg cggcgccgct cattag                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page