(data stored in ACNUC7421 zone)

EMBL: CP001349.PE79

CP001349.PE79        Location/Qualifiers
FT   CDS_pept        87265..87861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0081"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Hypothetical protein CBG04830"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55131"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU86"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55131.1"
FT                   /translation="MAVAQHTDQSKKTEQIRRIADPAQESVDRAAETGSEAVNLAKENL
FT                   SRVSDLRDRAADNALQVVQMSVETIARNTRELNDQITRTFGFGSEDSERLADQSRQNAE
FT                   AIARCGTVLTQAVQDAFRNSFELGQKRWQSNLDGLNKLTRARSVHELAMLQSEVARESL
FT                   QNLVQDTRTVAESSLRAFEEASRICASVKPLAQIR"
     atggccgtcg ctcagcatac cgatcagagc aagaagaccg agcagatccg caggatcgcg        60
     gacccggcgc aagagagtgt cgacagagca gccgagactg gttcagaggc ggtcaatctt       120
     gccaaggaga acttgagcag agtgtccgat ctgcgcgacc gcgcggccga caacgcattg       180
     caggtcgtgc agatgagcgt tgagacgatc gcaaggaaca ctcgcgaact caacgatcaa       240
     atcacgagga cttttggctt cggcagcgag gatagcgaac gcttggccga ccaatcccgg       300
     cagaacgcgg aagccatcgc ccgctgcggc acggtgctga cccaggctgt gcaggatgcc       360
     ttccggaaca gcttcgagct gggtcagaag cggtggcaaa gcaacctcga cggcttgaac       420
     aagctgaccc gagccaggtc ggtgcacgaa ctcgccatgc ttcagagcga agtggctcgc       480
     gagagcctgc aaaaccttgt tcaggacacg cgtacggtgg ccgagtcgtc gctgcgggcc       540
     ttcgaggaag ccagcagaat ctgcgccagc gtgaagccgc tcgcgcagat ccgctag          597
//

If you have problems or comments...

PBIL Back to PBIL home page