(data stored in ACNUC7421 zone)

EMBL: CP001349.PE8

CP001349.PE8         Location/Qualifiers
FT   CDS_pept        12368..12604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0009"
FT                   /product="BolA family protein"
FT                   /note="PFAM: BolA family protein; KEGG: met:M446_0006 BolA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55060"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ8"
FT                   /inference="protein motif:PFAM:PF01722"
FT                   /protein_id="ACL55060.1"
FT                   /translation="MPMDAREIEAMIREALPDAKIEIRDLAGDGDHYAATVLSSSFKGK
FT                   SRVQQHQMVYGALQGRMGGVLHALALTTGVPQD"
     atgcccatgg acgcccgcga gatcgaggcg atgatccggg aggctctccc ggatgccaag        60
     atcgagatcc gcgacctcgc cggcgatggc gaccactacg ccgccaccgt cctgtcctcg       120
     tccttcaagg gcaagtcgcg ggtgcagcag caccagatgg tctacggcgc attgcagggt       180
     cgcatggggg gcgtgctcca cgcgcttgcg ctgacgacgg gcgtccccca ggattag          237
//

If you have problems or comments...

PBIL Back to PBIL home page