(data stored in ACNUC7421 zone)

EMBL: CP001349.PE80

CP001349.PE80        Location/Qualifiers
FT   CDS_pept        89014..89613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0083"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55132"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU87"
FT                   /inference="similar to AA sequence:KEGG:M446_3764"
FT                   /protein_id="ACL55132.1"
FT                   /translation="MDRRLALTALASAFAIPSFIGAAFAQNEPSSASKSTGNTGARMGE
FT                   AEAKHAADTLAAGSLALAASRIALKKAKDDDVKQFAQFEVAEQETIADVLKAMRDPSTP
FT                   ASGQVKAPSEPEVTGQIDSRGKATLDKLEQAKAGPAFDAEYIKGQIEGHQSLLKIQEDY
FT                   LATGKDRENLGAAKLARGMIKEHLALLSDIKKDLKE"
     atggaccgtc gccttgcact taccgcccta gcttcggctt tcgccattcc gtccttcatt        60
     ggcgctgcct ttgcgcagaa cgagccaagc tccgcttcga aatccactgg gaacactggc       120
     gccaggatgg gtgaggccga ggccaagcac gcggctgaca ctctcgcggc tggctcattg       180
     gccctcgctg ccagtcggat agcgctcaaa aaggcaaagg atgacgacgt taagcagttt       240
     gcgcagttcg aagtcgccga acaggagacc atcgctgatg tgctgaaggc gatgcgggac       300
     ccgagcaccc cggccagcgg gcaggtgaag gcgccctccg agccggaagt gacaggtcaa       360
     atcgactcca ggggcaaggc aacactagac aagctggagc aggcaaaggc cggtcccgcg       420
     ttcgatgcag agtacatcaa aggacaaatc gagggacatc aatcgctctt gaaaatccaa       480
     gaggactatc tggcaacagg caaggaccgt gagaacttag gagccgcgaa gcttgctcgt       540
     ggcatgatca aagagcactt agctttgctg tctgatatca agaaagactt gaaagaatga       600
//

If you have problems or comments...

PBIL Back to PBIL home page