(data stored in ACNUC7421 zone)

EMBL: CP001349.PE84

CP001349.PE84        Location/Qualifiers
FT   CDS_pept        91955..92227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_0718 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55136"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU91"
FT                   /inference="similar to AA sequence:KEGG:M446_0718"
FT                   /protein_id="ACL55136.1"
FT                   /translation="MKRTIMLLAAATLMGSAAYAAEEGAAAGAAAGAAVGGPVGAAVGA
FT                   GVGHAATGPDRTGTVIERRSGCSHTTVRKENDVGESKTVHREDCD"
     atgaagcgga cgatcatgtt gctcgcagct gccacgctga tggggtcggc agcgtatgct        60
     gcggaggaag gtgcagcagc cggggctgct gcgggtgcag ctgtcggcgg cccggtcggc       120
     gcggcagtgg gagccggcgt ggggcatgcc gcaaccgggc cagatcgtac cggtacggtc       180
     attgaacggc ggagcggctg ctctcacacc accgttcgca aggagaacga cgtgggcgaa       240
     tccaagacgg tgcaccggga ggactgcgat tag                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page