(data stored in ACNUC7421 zone)

EMBL: CP001349.PE85

CP001349.PE85        Location/Qualifiers
FT   CDS_pept        92845..93063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0088"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_6754 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55137"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU92"
FT                   /inference="similar to AA sequence:KEGG:M446_6754"
FT                   /protein_id="ACL55137.1"
FT                   /translation="MLVFLNDTLLSVVTQLRNSVGEEFAGRWFIEAGFGPCSRTPSQVF
FT                   DTAEDAMQWVRGCLEEDATVWEHEAVA"
     atgctggtgt tcttgaacga cacccttctc tcggttgtca cccagcttcg caattcggtg        60
     ggtgaggagt tcgccggccg ctggttcatc gaagcaggct tcggtccttg ctcacggaca       120
     ccatctcagg tgttcgatac cgctgaggac gcaatgcagt gggtaagagg ttgcctcgaa       180
     gaggacgcta ccgtttggga gcacgaagct gtggcctag                              219
//

If you have problems or comments...

PBIL Back to PBIL home page