(data stored in ACNUC7421 zone)

EMBL: CP001349.PE86

CP001349.PE86        Location/Qualifiers
FT   CDS_pept        complement(93415..95358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0089"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   TPR repeat-containing protein; SMART: Tetratricopeptide
FT                   domain protein; KEGG: met:M446_0534 adenylate/guanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55138"
FT                   /db_xref="GOA:B8IU93"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU93"
FT                   /inference="protein motif:PFAM:PF00211"
FT                   /protein_id="ACL55138.1"
FT                   /translation="MDQTIADRRLVTILVADVVGYSRLIGADETGTLRRLKALRRDVIG
FT                   PSIAASKGRIIKTVGDGFIAEFGSAVRAVNCAISIQQGLARHEAGIAEDRALRLRIGIN
FT                   LGDVVVEPDGDLYGDGVNVAARLEPLSEAGGICLSRSVYDQVRDKLRYPFQDRGKLELK
FT                   NIARPVGVFSLPASAIADLTDTDEQVPEPVKTSNRKPWKATAVGAGFLTLLAAGGLGWW
FT                   SWTASKAPAPNQTIAAKLAGETREAPRLSIVVLPFSNLSNDPEQDYFADSITEDLTTDL
FT                   SHLAGSFVIARNTAFTYKNKPVDVKQIGRELGVRYVLEGSVRRTGEKVVLNSQLISAET
FT                   GAHIWSDRFDGDRSRLGDLQVEFVARLARSLDVQLTEAESLRSFRERPVNLDASDLAMR
FT                   GWASLNKQRSVANNNEAVQYFSQALKLDPNLPRAVLGLSRALMNKVINRWSEDIQADIE
FT                   GSDGLITKYIEKFPSDAAALVVKGDVFRSNKHFDAALAMYDAAIVANRNFAAAYALKGH
FT                   VSLLSGKAYAAIPSEIEAIRISPRDPLVNVWYYFVCHAHTHMAQWEEAIAWCNKCVAIS
FT                   PFWQAYIDLAAAYAWTGRAYEAKAAVSELLKLMPGYTVKKWATAGWSNHSRFLEEYQLI
FT                   VEGLRKAGLQEE"
     atggaccaga cgattgcgga ccgtcgtctc gtaaccattc ttgtggctga tgtggttggg        60
     tattcccgcc ttatcggtgc tgacgagacg ggcaccctgc gacgcctcaa ggccctccgc       120
     cgggacgtta tcggcccgag cattgcagct tcgaagggcc gtatcattaa gacggtcgga       180
     gatgggttca ttgccgagtt tggcagtgct gtaagagctg tgaactgtgc gatctccatc       240
     cagcagggac ttgctcgcca tgaggcaggg atagcggagg atcgtgctct ccggcttagg       300
     atcggtatca acctcggtga tgtggtcgtg gagcctgacg gcgacctgta tggcgatggg       360
     gtcaatgtcg ctgcccgcct tgagccgtta tcggaggcag gagggatctg cctctctcgt       420
     tccgtctacg atcaggtgag ggacaagctc cggtatccgt ttcaggatcg aggcaagctg       480
     gaacttaaga atatcgcccg gccagtgggg gtgttctcac ttccagcctc tgccattgct       540
     gatctgaccg acaccgacga acaggtccca gagccggtca aaaccagcaa tcgtaagcct       600
     tggaaggcga ctgcggtcgg ggccggtttc ttgacgttgc tcgcagccgg agggcttggg       660
     tggtggtcct ggacggcttc aaaggcacct gcaccgaacc aaaccatcgc tgccaagctg       720
     gccggagaga cgagagaggc gcctcgctta tcgatagtgg ttttgccctt ctcaaacctg       780
     agcaatgacc cagagcagga ttacttcgcc gattctataa ccgaggatct cacaaccgac       840
     ctatcccact tggcgggcag ttttgtgatc gcccgcaata cggcattcac ctataagaac       900
     aagcccgtgg atgtaaaaca gatcggacgg gaacttggtg tgcgctatgt attggaagga       960
     agtgtgcgta ggactggtga gaaggttgtc ttaaactcac agcttatctc ggctgagact      1020
     ggcgcacata tctggtctga tcgcttcgac ggtgatcgaa gccggctagg ggatctccag      1080
     gtagagttcg tcgcccgcct agctcgatca ctcgacgttc agttaactga agcggagagc      1140
     ttgcgttcat ttcgtgagcg gccggtcaat ctcgacgcct ccgacttggc gatgagaggc      1200
     tgggcttcgc tcaacaagca gagatcggtg gccaataaca atgaagcagt tcaatatttc      1260
     agccaagctc tgaagctgga tcctaatctc ccaagggctg ttctcggcct ttcgagggcc      1320
     ttgatgaaca aagttataaa tcgctggagt gaagacattc aggccgatat agaaggatca      1380
     gatgggctga taacgaaata catcgaaaaa ttcccgtctg atgctgctgc tcttgtcgtc      1440
     aaaggcgatg tgttcaggtc aaataagcac ttcgacgcag ctttagccat gtatgatgct      1500
     gcaatcgtgg caaataggaa cttcgcggct gcatatgcgc tcaaaggcca tgtttcactt      1560
     ttgtcaggaa aggcatacgc tgctattccc agcgagattg aggcaatccg gatcagccca      1620
     cgcgatcccc ttgtgaatgt gtggtactat ttcgtgtgcc acgcccatac tcatatggcg      1680
     cagtgggaag aagcaattgc atggtgtaac aagtgtgttg cgatctcacc attctggcaa      1740
     gcctacattg atctagctgc agcttatgca tggactggac gagcctacga ggccaaagct      1800
     gcagtttcgg aattattgaa gctgatgccc ggctacacgg ttaaaaaatg ggcgacagcc      1860
     ggatggtcca accattcgag gttcttggag gaataccagc tcattgtcga gggcttgaga      1920
     aaagccggcc tgcaggaaga atag                                             1944
//

If you have problems or comments...

PBIL Back to PBIL home page