(data stored in ACNUC7421 zone)

EMBL: CP001349.PE88

CP001349.PE88        Location/Qualifiers
FT   CDS_pept        96128..96322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55140"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU95"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55140.1"
FT                   /translation="MEDANVCVSHSIQGVEAWVVMQNEFHRRLKAFVSRDLALTNGMKL
FT                   RSRENIQMSIGPKDIIGDV"
     gtggaggacg ccaacgtctg tgtgagccac agcattcaag gtgttgaagc ttgggttgtc        60
     atgcagaatg aatttcaccg tcgcctgaaa gccttcgtca gtcgtgatct ggccctgacc       120
     aacggcatga aattacgttc ccgtgagaac attcagatga gcatcgggcc caaggacatc       180
     atcggtgacg tctga                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page