(data stored in ACNUC7421 zone)

EMBL: CP001349.PE89

CP001349.PE89        Location/Qualifiers
FT   CDS_pept        97100..97657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0092"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kra:Krad_3536 helix-turn-helix
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55141"
FT                   /db_xref="GOA:B8IU96"
FT                   /db_xref="InterPro:IPR036444"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU96"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55141.1"
FT                   /translation="MYINWSKPVSGPDGVPIPTYGNYGGPGYSNGEILSSPNQSVDYSA
FT                   TPVDALDSLFRAHDMVYDSPSTLVRAEGDLALIMGIEHLSQTPMSGEESLYAGAALIFA
FT                   VEQLTVTNGHPELLSARQLAAAATTSEHDIAYGLTHLDPSDVAGGAGLLAHSAESITAD
FT                   VLSHEAFPSFVSGLMSPLHNSI"
     atgtatatca attggtcaaa gccggtttca ggaccagatg gcgttccgat cccaacttat        60
     ggcaactatg gagggccggg atattcgaat ggggaaattc tctcatcacc caatcagagc       120
     gtggactact cggccacgcc ggtcgacgca ttggattcgc tctttcgcgc ccacgatatg       180
     gtctacgact cgcccagcac gctggtgcgt gcagaaggtg atctcgccct gattatggga       240
     attgagcatc tgtctcaaac cccaatgtcg ggcgaggaaa gcctctatgc tggagccgcg       300
     ctcatttttg cagtcgagca gctgaccgtc accaatggtc acccggaact gctcagcgct       360
     cgccagctcg ccgcggcagc cacgacatct gagcacgaca tcgcctacgg gctgacgcac       420
     ctcgacccaa gcgacgtggc cggcggcgct ggtctgttgg cgcattcggc cgagagcatc       480
     accgccgatg tgctctctca cgaggcgttc ccttcctttg tttcaggatt gatgagcccg       540
     ctccataact cgatctga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page