(data stored in ACNUC7421 zone)

EMBL: CP001349.PE9

CP001349.PE9         Location/Qualifiers
FT   CDS_pept        12622..13137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0010"
FT                   /product="protein of unknown function DUF29"
FT                   /note="PFAM: protein of unknown function DUF29; KEGG:
FT                   mrd:Mrad2831_1125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55061"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ9"
FT                   /inference="protein motif:PFAM:PF01724"
FT                   /protein_id="ACL55061.1"
FT                   /translation="MDQPPLYEEDIVTWAEQQASALRSLAARPDLSNALDWDAVAEEIE
FT                   EVGASRIRATASALLLVLVHVLKYVSAPTAQSTRSWRAEVITFQTAARGLYTRSTRQRI
FT                   DWDDLWRSAKRNADASLHIHGDSLIEGLPEQMPFTPEELVAPDFDMDAALSRLGPLLAP
FT                   TGGRRRPT"
     atggaccagc ccccgctcta cgaggaggac attgtgacgt gggccgagca gcaggcatcg        60
     gccctgcgga gtttggccgc tcgtccggac ttgtcgaacg cgctcgattg ggacgccgtc       120
     gccgaggaga tcgaggaggt gggggcgtcg cgcattcggg cgactgcgag tgctctcttg       180
     ctcgttctgg tccatgtcct caagtacgtc tcggctccga cggcgcagtc gacgcggtcg       240
     tggcgggcgg aggtgatcac ctttcagacg gcggcccgcg gcctctacac gcgttccacg       300
     cgccagcgca tcgattggga cgatctgtgg cggtcggcga agcggaatgc cgatgcgtcc       360
     cttcacattc acggcgacag cctgatcgag ggactgccgg agcagatgcc cttcacgccc       420
     gaggagctgg ttgcaccgga tttcgacatg gacgcggcgc tgtcacgctt aggcccgctt       480
     ctcgcaccaa ccggcggccg acgccgcccg acctaa                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page