(data stored in ACNUC7421 zone)

EMBL: CP001349.PE90

CP001349.PE90        Location/Qualifiers
FT   CDS_pept        complement(99254..99505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55142"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU97"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55142.1"
FT                   /translation="MERPSYYRLRVHAGREDLIVNAPTERDICIAGEQIVRHLFRVDLT
FT                   AMYVIEGPDAECERRVRTYLIDVLSELGSSGRELHRLI"
     atggaacggc cttcctacta ccgcctccgt gttcatgctg gacgcgaaga cctcatcgtc        60
     aatgcgccaa ccgagcggga catctgcatt gctggcgagc agattgttcg ccacctcttc       120
     agagtggatc ttacggccat gtacgtgatc gagggtcccg acgccgagtg cgagcggcgg       180
     gtccggactt acctcataga tgtgctcagc gagttgggca gctctggaag agagctgcac       240
     cggctcatct ga                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page