(data stored in ACNUC7421 zone)

EMBL: CP001349.PE91

CP001349.PE91        Location/Qualifiers
FT   CDS_pept        99795..100073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55143"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU98"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55143.1"
FT                   /translation="MILPPHLHVEEGRSRARSRWFSVRHENLRANDVDPECNGLKLTGI
FT                   TGSELGKVALGKLSLVSKGDITNPKDEPRKSAWREDRYVPESIPLLR"
     atgattctgc ctccacacct ccacgtcgag gaaggcagga gcagagcacg aagccgctgg        60
     ttctctgtta gacacgaaaa tctgcgggcc aacgacgtcg atccggagtg caatggatta       120
     aaactcactg gcatcacggg cagcgaactc ggaaaggttg ccctgggcaa gctctccctt       180
     gtcagcaaag gtgacatcac gaacccgaaa gacgagccta ggaaatccgc ctggagagaa       240
     gatcgatacg taccggagtc aatccctctg ctcagataa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page