(data stored in ACNUC7421 zone)

EMBL: CP001349.PE92

CP001349.PE92        Location/Qualifiers
FT   CDS_pept        complement(100201..102144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0096"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   KEGG: met:M446_0534 adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55144"
FT                   /db_xref="GOA:B8IU99"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU99"
FT                   /inference="protein motif:PFAM:PF00211"
FT                   /protein_id="ACL55144.1"
FT                   /translation="MGRTITDRRLVTILVADVVSYSRLIGADETGTLRRLKALRRDVID
FT                   PSVTSVHGRIIKTMGGGFIAEFASAVRAVSCAVTIQQGLARHEAEIPDDRALRLRIGIN
FT                   LGDVVVEPDGDLYGDGVNVAARLEPLAEPGGICIARSVYDQVRDNLRYPFQDRGELELK
FT                   NIARPVGVYFLSASAIVGLAGTDEQAPEPVKTSNRKPWKATAVGAGFLTLLAAGGLGWW
FT                   SWTASKAPAPNQTIAAKLAGETREAPRLSIVVLPFSNLSNDPEQDYFADSITEDLTTDL
FT                   SHLAGSFVIARNTAFTYKNKPVGVKQIGQELGVRYVLEGSVRRSGERVVVSAELISAET
FT                   GAQIWFDRFDGDQSRLGDLQVEFVARLARSLDVQLTEAESLRSLRERPVNPDASDLAMR
FT                   GWASLNKQRSIANNNEAIRYFEQALKLDPTLPRATLGLSRALMNKVLNRWSDDIQSDTR
FT                   SADELVNRYLEKFPHDAAALVVKGDVFRADKYFDAAIAMYDAAISDNDDFAAAYAAKGQ
FT                   ASTLSGKAYAAIPNVLQAIRISPRDPLVNVWYYFVCHAHMHMAQWEEAISWCNRSVAVS
FT                   PYWLPYIDLAAAYAWVGHDQEAKAAVSELLKLTPGYTVKKWANAGWSNNPKFLEEYKLI
FT                   VDGLRKAGLQEE"
     atgggccgga cgattacaga ccgtcgtctc gtcacaatcc tagtagcgga cgtggtcagt        60
     tactcccgcc ttatcggtgc tgacgagacc ggcacgctac gacgcctcaa ggccctccgc       120
     cgagacgtaa tcgatccgag cgtcacctct gttcacgggc gtatcattaa gacgatgggg       180
     ggcgggttta ttgccgagtt cgccagtgcg gttagggctg tgagctgtgc ggtcaccatt       240
     cagcagggcc ttgcccgtca cgaggccgag ataccggacg accgtgccct tcgcctgcgc       300
     atcggcataa accttggtga tgtggtcgtg gagcccgatg gagacctcta tggcgacgga       360
     gtgaatgtcg ctgcccggct tgagccatta gccgagccag gggggatctg tatcgcccgc       420
     tccgtctacg atcaggtgag ggacaacctc cgatacccgt ttcaggatcg gggcgagctg       480
     gagcttaaaa atatcgcaag gcccgtagga gtctactttc tctcagcctc ggcaatagtt       540
     ggtctggccg gcaccgacga acaggcccca gagccggtca aaaccagcaa tcgtaagcct       600
     tggaaggcga ctgcggtcgg ggccggtttc ttgacgttgc tcgcagccgg agggcttggg       660
     tggtggtcct ggacggcttc aaaggcacct gcaccgaacc aaaccatcgc tgccaagctg       720
     gccggagaga cgagagaggc gcctcgctta tcgatagtgg ttttgccctt ttcaaatctg       780
     agcaatgacc cagagcagga ttacttcgcc gattctataa ccgaggatct cacgacagac       840
     ctatcccact tggcgggcag ttttgtgatc gcccgcaata cggctttcac gtataagaac       900
     aagccagtcg gcgtaaaaca gatcgggcaa gaacttggcg tccggtatgt tcttgagggc       960
     agcgttcgtc ggagtggtga gagggttgtt gtgagcgcag agcttatctc tgccgaaacc      1020
     ggtgctcaaa tttggtttga tcgtttcgac ggtgatcaaa gccggttggg cgaccttcag      1080
     gtagagtttg ttgcccgtct agctcggtcg ctcgacgttc agttgaccga agccgagagc      1140
     ctgcgttcac ttcgtgagcg gccggtcaat cctgatgcct ctgatttggc gatgagaggc      1200
     tgggcttcgc tcaataagca aagatcgata gccaacaata atgaagcaat ccggtacttt      1260
     gaacaagctt tgaaactgga tccgactctc ccaagggcca cgcttgggct ttcaagagct      1320
     ctgatgaaca aggtcttaaa ccgctggagc gatgatatac agtccgatac aaggtcagca      1380
     gatgagttgg taaatagata tcttgagaaa tttccccatg acgctgctgc gctcgttgtg      1440
     aagggtgatg tatttcgggc ggataaatac ttcgatgcgg ccattgctat gtatgatgcc      1500
     gcaatcagcg ataatgatga ttttgcggct gcgtatgcgg caaaaggtca agcatccact      1560
     ttatcgggta aggcatacgc tgccattcca aatgtgttac aagcaattcg gatcagccca      1620
     cgtgatcccc ttgtaaatgt ctggtattac tttgtgtgcc atgctcatat gcatatggcg      1680
     cagtgggaag aggcgatttc ctggtgcaat aggtccgtcg cagtctcacc atactggctc      1740
     ccctatattg atcttgcggc agcctatgcg tgggttggac atgatcagga ggcaaaagct      1800
     gcagtttccg agttattgaa gctgacgcct ggatataccg tcaagaaatg ggccaatgca      1860
     ggttggtcta acaatccaaa attcttggag gaatacaagc tcattgtcga tggtctgaga      1920
     aaagctggct tgcaggaaga atag                                             1944
//

If you have problems or comments...

PBIL Back to PBIL home page