(data stored in ACNUC7421 zone)

EMBL: CP001349.PE93

CP001349.PE93        Location/Qualifiers
FT   CDS_pept        complement(102570..102830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55145"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55145.1"
FT                   /translation="MLAIRSRAAFSCDRSVCDQGVQSVRQGPEWQPGPCSSLQILERNP
FT                   CLTMLGIKSFEDLLNCHALHGVGSWSPWPHVSSLPGANAEA"
     gtgctggcaa ttcggagccg ggcggccttc tcgtgcgacc gctccgtctg cgaccagggc        60
     gttcagagcg tccgtcaggg cccggaatgg cagccgggac cgtgcagcag tctccagatc       120
     cttgaacgga acccctgcct caccatgctg gggatcaaga gcttcgagga tctcctgaac       180
     tgtcacgccc tgcatggcgt cgggtcgtgg tccccgtggc cgcatgtgtc atctctcccc       240
     ggtgccaatg cggaagccta g                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page