(data stored in ACNUC7421 zone)

EMBL: CP001349.PE94

CP001349.PE94        Location/Qualifiers
FT   CDS_pept        103128..103847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55146"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55146.1"
FT                   /translation="MLRRRWSWQSARKLQATVPSLRTGLILRTAPRSCGHRKLRHPPTS
FT                   LLRTDETGASLVRKRQAICRPGGLPSEERSTKGELPDDNRSLDDLVVRSLEHTLGDEIL
FT                   RRGVGPEGDDPAPDHAGAECIQLLHGSRVEVGARPRRCRRIAGNRRCLRRYTGSQRTVT
FT                   LLLRRRKLGRRNLGRLRSCRRGNSRGRSRGSRFCYRSALRRRADRLCRSTQRARINRAD
FT                   GLPVGGGTLLGGQLGNS"
     ttgcttcgga ggcggtggtc ttggcagtca gccaggaagc tgcaagcgac ggttccgagc        60
     cttcgaactg gattgatcct ccgcaccgct cctcggagct gcggccacag gaagctacgg       120
     cacccaccga caagcctgct gaggactgac gagactggcg cttccctggt gaggaagcgc       180
     caagcgatct gccggcccgg cggcctgccg tcggaggaac gctccaccaa aggcgagcta       240
     ccggacgaca accgcagcct tgatgatctc gtagtccgct cgcttgagca cacgcttggt       300
     gacgagatcc tcaggcgagg cgtagggccg gaaggcgatg atcctgcgcc cgatcatgcc       360
     ggcgccgagt gcattcagct cctccacgga agccgtgttg aggtcggtgc ccggccccga       420
     aggtgccggc ggattgctgg gaaccgccgc tgtctccgtc gttacaccgg tagtcagcgt       480
     actgtcaccc tgctcctgag gcggcgtaag ctcgggcggc gcaatctggg ccgtctgagg       540
     agctgccgac gaggcaacag ccggggccgc agccggggga gccgattctg ctaccgctcc       600
     gctctgcggc ggagggctga tcggctgtgc cgatccaccc agagggcccg gataaaccgt       660
     gcggatgggc tgcccgtcgg gggtggaacg ctgttgggag gccaactggg aaacagttag       720
//

If you have problems or comments...

PBIL Back to PBIL home page