(data stored in ACNUC7421 zone)

EMBL: CP001349.PE95

CP001349.PE95        Location/Qualifiers
FT   CDS_pept        105255..106244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0100"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: met:M446_4738
FT                   ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55147"
FT                   /db_xref="GOA:B8IUA2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55147.1"
FT                   /translation="MDIELVGLTKRYGDTLAVDAISLKIRSGSYCCLLGPSGCGKTTTL
FT                   RMIAGHETVTSGDVVIGPKAVGDLAPARRGTAMMFQSYALFPHLTCRDNVAFGLRMRGM
FT                   PKAERNQRAEAMLRLVQMEALAGRLPAQLSGGQQQRVALARALVTGPKVLLLDEPLSAL
FT                   DPFLRVRMRAELKRIQTELGITFVHVTHSQDEAMALADLVVVMNGGRIEQAADPRTVFE
FT                   RPATAFVARFIGGHNVIALPDHRIAVRADRMLLGPEAGPDAVPARVVAVEYQGSAVHLG
FT                   LEAPDLATDAAAPLLAIVSDRAFAERPLAPGDTVRVGWQAGEAHRLDA"
     atggatatcg aactcgtcgg ccttaccaag cgctacggcg acaccctcgc cgtggatgcc        60
     atcagcctga agatccgctc cggctcctat tgctgcctgc tcggtccttc gggatgcggc       120
     aagaccacga cgctgcggat gatcgccggc cacgagaccg tgacgagcgg ggacgtggtg       180
     atcgggccga aggccgtcgg cgacttggcc cccgcccggc gcggcaccgc catgatgttc       240
     cagagctacg cgctcttccc gcatctcacc tgccgcgaca acgtcgcctt cgggttgcgc       300
     atgcgcggca tgccgaaggc cgagcggaac cagcgcgcgg aggcgatgct gcgcctcgtg       360
     cagatggagg ccctcgccgg gcgcctgccg gcgcagctct ccggcggcca gcagcagcgc       420
     gtggcgctgg cccgggccct cgtcaccggt ccgaaggtgc tgctgctcga cgagccgctc       480
     tccgccctcg atccgttcct gcgcgtgcgg atgcgcgccg agctgaagcg gatccagacg       540
     gaactcggca tcaccttcgt gcacgtgacc cacagccagg atgaagcgat ggcgctcgcc       600
     gacctcgtgg tggtgatgaa tggcggacgc atcgagcagg cggcggatcc ccgcacggtg       660
     ttcgaacggc ccgccaccgc cttcgtcgcc cgcttcatcg gcgggcacaa cgtcatcgcg       720
     ctgcccgacc atcgcatcgc cgtgcgggcc gatcgcatgc tgctcgggcc cgaagccgga       780
     cccgacgcgg tgcccgcccg cgtggtcgcg gtcgagtacc agggcagcgc cgtgcatctc       840
     ggcctcgagg ccccggatct cgccaccgat gcggcggccc cgctcctcgc catcgtcagc       900
     gaccgcgcct tcgcggagcg gccgctcgca cccggcgaca ccgtgcgggt cggctggcag       960
     gcgggcgaag cccaccggct ggatgcctga                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page