(data stored in ACNUC7421 zone)

EMBL: CP001349.PE96

CP001349.PE96        Location/Qualifiers
FT   CDS_pept        106269..107552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0101"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="KEGG: met:M446_4739 ABC transporter
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55148"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA3"
FT                   /inference="similar to AA sequence:KEGG:M446_4739"
FT                   /protein_id="ACL55148.1"
FT                   /translation="MTDTPNTKGLTRRGLLAGAGAAGVAAGSGAITGFPAVHAAEPVTL
FT                   RYLGTAVNQSGDIARKVKEDLGITIEYIPVVTDEVSKRVVTQPNSFDIVDSEYFSLKKL
FT                   MPSGNLVGMDARRIKYADKITPVFTRGEVAGKKIGDQGTAPRKVFYLEGQNSTKFAASA
FT                   TEWITLIPTTYNADTLGIRPDLIKRPIASWKELLNPEFKGRASILNIPSIGIMDAAMVV
FT                   EAMGEYTYPDKGNMTKAEIDRTMKVLIEAKRAGQFRAFWQDFNESVNLMASGETVIQSM
FT                   WSPAVTKVRSQGVPCIYQPLKEGYRAWASGFGLPKTLSGRKLDAAYDFINWFLSGWAGA
FT                   YLNRQGYYSAVLETARAQMEPYEWAYWMEGKPAEKDIKAPDGTVMEKAGAVRDGGSFEE
FT                   RMGAVACWNSVMDENTYMVRRWNEFIAA"
     atgaccgaca cgccgaacac gaagggcctc acgcgccgcg gccttctcgc gggggcggga        60
     gccgccggcg tcgcggccgg gtccggcgcc atcacgggct ttccggcggt ccacgccgcg       120
     gagccggtga cgctgcgcta tctcggcacc gccgtgaacc agagcggcga catcgcccgc       180
     aaggtgaagg aggatctcgg catcacgatc gagtacatcc cggtcgtcac cgacgaggtg       240
     tcgaagcgcg tcgtcaccca gcccaactcc ttcgacatcg tcgattcgga atatttcagc       300
     ctcaagaagc tgatgccctc gggcaatctc gtcgggatgg atgcgcgcag gatcaagtac       360
     gccgacaaga tcacgccggt cttcacccgc ggcgaggtcg ccggcaaaaa gatcggcgac       420
     cagggcaccg cgcccaggaa ggtcttctac ctcgaaggcc agaactcgac gaagttcgcc       480
     gcctctgcca ccgagtggat caccctgatc ccgacgacct acaatgccga taccctcggc       540
     atccggcctg acctgatcaa gcggccgatc gcaagctgga aggaactgct caaccccgag       600
     ttcaagggca gggcctcgat cctcaacatc ccgtcgatcg gcatcatgga cgccgccatg       660
     gtggttgagg cgatgggcga gtacacctat cccgacaagg gcaacatgac gaaggcggag       720
     atcgaccgca ccatgaaggt gctgatcgag gccaagcgcg ccggccagtt ccgggccttc       780
     tggcaggact tcaacgagtc cgtgaacctg atggcctcgg gcgagaccgt catccagtcg       840
     atgtggtcgc ccgccgtcac caaggtccgc tcgcagggcg tgccctgcat ctaccagccg       900
     ctgaaggagg gctaccgggc ctgggcctcg ggcttcggcc tgcccaagac cctctcgggc       960
     aggaagctcg acgcggccta cgacttcatc aactggttcc tgtccggctg ggccggcgcc      1020
     tacctcaacc gccagggcta ctactcggcg gtgctggaga ccgccagggc ccagatggag      1080
     ccctacgaat gggcctactg gatggagggc aagccggcgg agaaggacat caaggcgccg      1140
     gacggcaccg tgatggagaa ggccggcgcc gtgcgcgacg gcggctcctt cgaggagcgc      1200
     atgggcgcgg tggcctgctg gaactcggtc atggacgaga acacctacat ggtccgccgg      1260
     tggaacgagt tcatcgccgc atga                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page