(data stored in ACNUC7421 zone)

EMBL: CP001349.PE97

CP001349.PE97        Location/Qualifiers
FT   CDS_pept        107549..108502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0102"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_4740
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55149"
FT                   /db_xref="GOA:B8IUA4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55149.1"
FT                   /translation="MSPAAERAIRLLGAAAVPRAVPGLAAEGWRQRRLAYLQAAPLALV
FT                   FLVFFVVPLSLTLVVSVWEYNEYEIIPAFTLQNYADIFDGCFSGGDLCTTFRTYLSTLK
FT                   FCLLAWAFTLGIGFTVAYFVAFHVRSSAIQTVLFLLCTIPFWTSNVIRMIAWIPLLGRN
FT                   GLVNDALMSLGLTDRPIEGLLYSDFSVVLAFVHLYTVFMIVPIFNSMMRIDPVLIEAAR
FT                   DAGATGWQTLWSVIVPLSKPGIAIGSIFVLTLAMGDFVTVGVMGGQQIASVGKVIQVQM
FT                   SYLQFPAAAANAVVLLGAVTLVIAGLTRLIDLRREL"
     atgagcccgg cggccgagcg cgcgatccgg ttgctcggtg ccgcggcggt gccccgcgcc        60
     gtgcccgggc tcgccgcgga ggggtggcgc cagcgccgcc tcgcctacct gcaggcggcc       120
     cctctggcgc tggtcttcct cgtcttcttc gtggtgccgc tctccctcac gctcgtcgtc       180
     agcgtctggg agtacaacga gtacgagatc atcccggcct tcaccctgca gaactacgcc       240
     gacatcttcg atggctgctt ctcgggcggg gacctctgca ccaccttccg gacctatctc       300
     tcgacgctga aattctgcct gctggcctgg gccttcacgc tcggcatcgg cttcacggtg       360
     gcctatttcg tggccttcca cgtgcggtcg agcgccattc agacggtgct gttccttctc       420
     tgcaccatcc cgttctggac ctcgaacgtg atccggatga tcgcctggat cccactcctc       480
     ggccgcaacg gcctcgtcaa cgatgcgctg atgtcgctcg gcctcacgga caggccgatc       540
     gagggcctgc tctactcgga cttctcggtc gtcctggcct tcgtgcacct ctacaccgtc       600
     ttcatgatcg tcccgatctt caactcgatg atgcgcatcg accccgtgct gatcgaggcg       660
     gcgcgggatg ccggcgcgac gggctggcag acgctctgga gcgtgatcgt gccgctctcc       720
     aagcccggca tcgccatcgg gtcgatcttc gtgctgacgc tggcgatggg cgacttcgtc       780
     acggtcggcg tcatgggcgg ccagcagatc gcctcggtcg gcaaggtcat ccaggtgcag       840
     atgtcctacc tgcagttccc ggccgccgcc gccaatgccg tggtgctgct cggtgcggtg       900
     acgctggtga tcgccggcct cacccgcctc atcgatctgc ggcgggagct ctga             954
//

If you have problems or comments...

PBIL Back to PBIL home page