(data stored in ACNUC7421 zone)

EMBL: CP001349.PE98

CP001349.PE98        Location/Qualifiers
FT   CDS_pept        108505..109398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0103"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_4741
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55150"
FT                   /db_xref="GOA:B8IUA5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55150.1"
FT                   /translation="MVRDGPRPLAFYLLAGFFALYVLFLYGPTLTILVLSFQGPQGGLT
FT                   FPMNGVSTHWFARLWAGLGVVDIWAAFRRSFALGLVVMALTVTLAFFAGLAFRKGFRGQ
FT                   GLLFHIAVASLIVPSIVVSLGIGLEFRLLDDAVKALAAATGWGFLQDHGTVMGLFTSAL
FT                   GAHLTWTLPFGLLIMFAVFNRFNRAYEEAARDLGASGPRTLLHVVIPIILPSLVGVALF
FT                   GFTLSWDELARTSQAIGGRNTLPLELQGLTTTVTTPEIYALGTVTTGVSLVVIALAFSS
FT                   YLWLQRRRARRALPGG"
     atggtccgcg acggcccccg ccccctcgcc ttctacctgc tcgccgggtt cttcgctctg        60
     tacgtgctgt tcctctacgg gccgacgctg acgatcctgg tcctgagctt ccaggggcct       120
     cagggcgggc tcaccttccc gatgaacggc gtctcgacgc attggttcgc gcggctctgg       180
     gcgggtctcg gcgtcgtcga catctgggcg gcgttccggc gctccttcgc cctcggcctc       240
     gtggtgatgg cgctcaccgt caccctggcg ttcttcgccg ggctcgcctt ccgcaagggg       300
     ttccggggac agggcctgct gttccacatc gcggtcgcga gcctgatcgt gccgtcgatc       360
     gtggtctccc tcggcatcgg cctcgaattc cgcctgctcg acgatgccgt caaggcgctc       420
     gccgccgcca ccggctgggg cttcctccag gaccacggca cggtgatggg gctgttcacc       480
     tccgccctcg gcgcgcacct gacctggacg ctgcccttcg ggctgctgat catgttcgcg       540
     gtgttcaacc gcttcaaccg cgcctacgag gaggcggccc gcgacctcgg cgccagcggc       600
     ccgcgcacgc tcctgcacgt cgtgattccg atcatcctgc cttccctggt cggcgtcgcc       660
     ctgttcgggt tcacgctctc ctgggacgag ctcgcgcgca cgagccaggc gatcggcgga       720
     cgcaataccc tgcccctcga actccagggc ctcaccacca cggtgacgac gccggagatc       780
     tacgcgctcg gcaccgtcac gacgggcgtg tcgctggtcg tgatcgcgct cgccttctcg       840
     agctatctct ggctgcagcg gcggcgggcc cggcgcgcgc tgcccggggg gtga             894
//

If you have problems or comments...

PBIL Back to PBIL home page