(data stored in ACNUC7421 zone)

EMBL: CP001349.PE99

CP001349.PE99        Location/Qualifiers
FT   CDS_pept        109724..110560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0104"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   met:M446_1731 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55151"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACL55151.1"
FT                   /translation="MGIEAGTPRNAAAPSARLAGKVALVFGAGSSGPGWSNGKAVAVTF
FT                   ARAGARVVCIDLDPAAAEETVSIIRHDDGSATAASCDVTNSDAVRAVVEDAVAAHGRID
FT                   ILHNNVGHATMGGPVELDEAAWRRSLDLNLTSCFLTCKHVLPHMLAQRSGSIVNISSVA
FT                   AVRYTGYPYAAYYAAKAAVNHFTVGLALQYAREGIRANAIMPGMMNTPLIFRQIAGQYA
FT                   DADEMVRARDAACPMGRMGTAWDVANAALFLASDEAAYITGVALPVDGGLIARAGS"
     atgggcatcg aggccgggac gccgcggaac gcggccgcgc cgagcgcacg tctcgccgga        60
     aaagtggcgc tggtgttcgg ggcaggctcg tccggcccgg gctggagcaa cggcaaggcc       120
     gtcgccgtga ccttcgcccg cgcgggggcg cgcgtcgtct gcatcgatct cgatccggcc       180
     gccgccgagg agaccgtctc gatcatccgc cacgacgacg gttcggccac cgccgcgtcc       240
     tgcgacgtga ccaactcgga cgccgtccgg gcggtggtgg aggacgcggt cgcggcgcat       300
     ggccggatcg acatccttca caacaatgtc ggccacgcca ccatgggcgg gcccgtcgag       360
     ctcgacgagg ccgcatggcg gcgcagcctc gatctcaacc tcacgagctg tttcctcacc       420
     tgcaagcacg tgctgccgca catgctcgcg cagcgctccg gcagcatcgt caacatctcg       480
     tcggtcgcgg cggtgcgcta caccggctat ccctacgccg cctattacgc agccaaggcc       540
     gccgtgaacc acttcacggt ggggctcgcc ctccagtacg cccgcgaggg catccgggcg       600
     aacgccatca tgccgggcat gatgaacacg ccgctgatct tccggcagat cgccggccaa       660
     tacgccgatg ccgacgagat ggtgagggcc cgcgatgcgg cctgcccgat gggccggatg       720
     ggaaccgcct gggacgtggc gaacgccgcc ctgttcctcg cctccgacga ggccgcctac       780
     atcacgggcg tggcgctgcc ggtcgatggc ggcctgatcg cgcgggcagg ctcgtga          837
//

If you have problems or comments...

PBIL Back to PBIL home page