(data stored in ACNUC7421 zone)

EMBL: CP001389

ID   CP001389; SV 1; circular; genomic DNA; STD; PRO; 3925702 BP.
XX
AC   CP001389;
XX
PR   Project:PRJNA21101;
XX
DT   24-APR-2009 (Rel. 100, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 5)
XX
DE   Sinorhizobium fredii NGR234, complete genome.
XX
KW   .
XX
OS   Sinorhizobium fredii NGR234
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales; Rhizobiaceae;
OC   Sinorhizobium/Ensifer group; Sinorhizobium.
XX
RN   [1]
RP   1-3925702
RX   DOI; 10.1128/AEM.00515-09.
RX   PUBMED; 19376903.
RA   Schmeisser C., Liesegang H., Krysciak D., Bakkou N., Le Quere A.,
RA   Wollherr A., Heinemeyer I., Morgenstern B., Pommerening-Roser A.,
RA   Flores M., Palacios R., Brenner S., Gottschalk G., Schmitz R.A.,
RA   Broughton W.J., Perret X., Strittmatter A.W., Streit W.R.;
RT   "Rhizobium sp. strain NGR234 possesses a remarkable number of secretion
RT   systems";
RL   Appl. Environ. Microbiol. 75(12):4035-4045(2009).
XX
RN   [2]
RP   1-3925702
RA   Liesegang H., Krysziak D., Schmeisser C., Bakkou N., Le Quere A.,
RA   Strittmatter A.W., Wollherr A., Heinemeyer I., Morgenstern B.,
RA   Gottschalk G., Schmitz R.A., Broughton W.J., Perret X., Streit W.R.;
RT   ;
RL   Submitted (29-OCT-2007) to the INSDC.
RL   Institute of Microbiology and Genetics, Goettingen Genomics Laboratory,
RL   Grisebachstrasse 8, Goettingen, Lower Saxony D-37077, Germany
XX
DR   MD5; 775cec326c659b6b2eb2af692c795169.
DR   BioSample; SAMN02603283.
DR   EnsemblGenomes-Gn; EBG00001099032.
DR   EnsemblGenomes-Gn; EBG00001099033.
DR   EnsemblGenomes-Gn; EBG00001099034.
DR   EnsemblGenomes-Gn; EBG00001099035.
DR   EnsemblGenomes-Gn; EBG00001099036.
DR   EnsemblGenomes-Gn; EBG00001099037.
DR   EnsemblGenomes-Gn; EBG00001099038.
DR   EnsemblGenomes-Gn; EBG00001099039.
DR   EnsemblGenomes-Gn; EBG00001099040.
DR   EnsemblGenomes-Gn; EBG00001099041.
DR   EnsemblGenomes-Gn; EBG00001099042.
DR   EnsemblGenomes-Gn; EBG00001099043.
DR   EnsemblGenomes-Gn; EBG00001099044.
DR   EnsemblGenomes-Gn; EBG00001099045.
DR   EnsemblGenomes-Gn; EBG00001099046.
DR   EnsemblGenomes-Gn; EBG00001099047.
DR   EnsemblGenomes-Gn; EBG00001099048.
DR   EnsemblGenomes-Gn; EBG00001099049.
DR   EnsemblGenomes-Gn; EBG00001099050.
DR   EnsemblGenomes-Gn; EBG00001099051.
DR   EnsemblGenomes-Gn; EBG00001099052.
DR   EnsemblGenomes-Gn; EBG00001099053.
DR   EnsemblGenomes-Gn; EBG00001099054.
DR   EnsemblGenomes-Gn; EBG00001099055.
DR   EnsemblGenomes-Gn; EBG00001099056.
DR   EnsemblGenomes-Gn; EBG00001099057.
DR   EnsemblGenomes-Gn; EBG00001099058.
DR   EnsemblGenomes-Gn; EBG00001099059.
DR   EnsemblGenomes-Gn; EBG00001099060.
DR   EnsemblGenomes-Gn; EBG00001099061.
DR   EnsemblGenomes-Gn; EBG00001099062.
DR   EnsemblGenomes-Gn; EBG00001099063.
DR   EnsemblGenomes-Gn; EBG00001099064.
DR   EnsemblGenomes-Gn; EBG00001099065.
DR   EnsemblGenomes-Gn; EBG00001099066.
DR   EnsemblGenomes-Gn; EBG00001099067.
DR   EnsemblGenomes-Gn; EBG00001099068.
DR   EnsemblGenomes-Gn; EBG00001099069.
DR   EnsemblGenomes-Gn; EBG00001099070.
DR   EnsemblGenomes-Gn; EBG00001099071.
DR   EnsemblGenomes-Gn; EBG00001099072.
DR   EnsemblGenomes-Gn; EBG00001099073.
DR   EnsemblGenomes-Gn; EBG00001099074.
DR   EnsemblGenomes-Gn; EBG00001099075.
DR   EnsemblGenomes-Gn; EBG00001099076.
DR   EnsemblGenomes-Gn; EBG00001099077.
DR   EnsemblGenomes-Gn; EBG00001099078.
DR   EnsemblGenomes-Gn; EBG00001099079.
DR   EnsemblGenomes-Gn; EBG00001099080.
DR   EnsemblGenomes-Gn; EBG00001099081.
DR   EnsemblGenomes-Gn; EBG00001099082.
DR   EnsemblGenomes-Gn; EBG00001099083.
DR   EnsemblGenomes-Gn; EBG00001099084.
DR   EnsemblGenomes-Gn; EBG00001099085.
DR   EnsemblGenomes-Gn; EBG00001099086.
DR   EnsemblGenomes-Gn; EBG00001099087.
DR   EnsemblGenomes-Gn; EBG00001099088.
DR   EnsemblGenomes-Gn; EBG00001099089.
DR   EnsemblGenomes-Gn; EBG00001099090.
DR   EnsemblGenomes-Gn; EBG00001099092.
DR   EnsemblGenomes-Gn; EBG00001099093.
DR   EnsemblGenomes-Gn; EBG00001099094.
DR   EnsemblGenomes-Gn; EBG00001099095.
DR   EnsemblGenomes-Gn; EBG00001099096.
DR   EnsemblGenomes-Gn; EBG00001099097.
DR   EnsemblGenomes-Gn; EBG00001099098.
DR   EnsemblGenomes-Gn; EBG00001099099.
DR   EnsemblGenomes-Gn; EBG00001099100.
DR   EnsemblGenomes-Gn; EBG00001099101.
DR   EnsemblGenomes-Gn; EBG00001099102.
DR   EnsemblGenomes-Gn; EBG00001099103.
DR   EnsemblGenomes-Gn; EBG00001099104.
DR   EnsemblGenomes-Gn; EBG00001099105.
DR   EnsemblGenomes-Gn; EBG00001099106.
DR   EnsemblGenomes-Gn; EBG00001099107.
DR   EnsemblGenomes-Gn; EBG00001099108.
DR   EnsemblGenomes-Gn; EBG00001099109.
DR   EnsemblGenomes-Gn; EBG00001099110.
DR   EnsemblGenomes-Gn; EBG00001099111.
DR   EnsemblGenomes-Gn; EBG00001099112.
DR   EnsemblGenomes-Gn; EBG00001099113.
DR   EnsemblGenomes-Gn; EBG00001099114.
DR   EnsemblGenomes-Gn; EBG00001099115.
DR   EnsemblGenomes-Gn; EBG00001099116.
DR   EnsemblGenomes-Gn; EBG00001099117.
DR   EnsemblGenomes-Gn; EBG00001099118.
DR   EnsemblGenomes-Gn; EBG00001099119.
DR   EnsemblGenomes-Gn; EBG00001099120.
DR   EnsemblGenomes-Gn; EBG00001099121.
DR   EnsemblGenomes-Gn; EBG00001099122.
DR   EnsemblGenomes-Gn; EBG00001099123.
DR   EnsemblGenomes-Gn; NGR_c00890.
DR   EnsemblGenomes-Gn; NGR_c01390.
DR   EnsemblGenomes-Gn; NGR_c01590.
DR   EnsemblGenomes-Gn; NGR_c02200.
DR   EnsemblGenomes-Gn; NGR_c02300.
DR   EnsemblGenomes-Gn; NGR_c03370.
DR   EnsemblGenomes-Gn; NGR_c03710.
DR   EnsemblGenomes-Gn; NGR_c05600.
DR   EnsemblGenomes-Gn; NGR_c05680.
DR   EnsemblGenomes-Gn; NGR_c05730.
DR   EnsemblGenomes-Gn; NGR_c08130.
DR   EnsemblGenomes-Gn; NGR_c08830.
DR   EnsemblGenomes-Gn; NGR_c10070.
DR   EnsemblGenomes-Gn; NGR_c10450.
DR   EnsemblGenomes-Gn; NGR_c10460.
DR   EnsemblGenomes-Gn; NGR_c10470.
DR   EnsemblGenomes-Gn; NGR_c11190.
DR   EnsemblGenomes-Gn; NGR_c11710.
DR   EnsemblGenomes-Gn; NGR_c11720.
DR   EnsemblGenomes-Gn; NGR_c11750.
DR   EnsemblGenomes-Gn; NGR_c12330.
DR   EnsemblGenomes-Gn; NGR_c13130.
DR   EnsemblGenomes-Gn; NGR_c13910.
DR   EnsemblGenomes-Gn; NGR_c14050.
DR   EnsemblGenomes-Gn; NGR_c14060.
DR   EnsemblGenomes-Gn; NGR_c14090.
DR   EnsemblGenomes-Gn; NGR_c14100.
DR   EnsemblGenomes-Gn; NGR_c14150.
DR   EnsemblGenomes-Gn; NGR_c14170.
DR   EnsemblGenomes-Gn; NGR_c14440.
DR   EnsemblGenomes-Gn; NGR_c14840.
DR   EnsemblGenomes-Gn; NGR_c15030.
DR   EnsemblGenomes-Gn; NGR_c15050.
DR   EnsemblGenomes-Gn; NGR_c15080.
DR   EnsemblGenomes-Gn; NGR_c15620.
DR   EnsemblGenomes-Gn; NGR_c15630.
DR   EnsemblGenomes-Gn; NGR_c16110.
DR   EnsemblGenomes-Gn; NGR_c19250.
DR   EnsemblGenomes-Gn; NGR_c21170.
DR   EnsemblGenomes-Gn; NGR_c22590.
DR   EnsemblGenomes-Gn; NGR_c23880.
DR   EnsemblGenomes-Gn; NGR_c24250.
DR   EnsemblGenomes-Gn; NGR_c26470.
DR   EnsemblGenomes-Gn; NGR_c26480.
DR   EnsemblGenomes-Gn; NGR_c26490.
DR   EnsemblGenomes-Gn; NGR_c26500.
DR   EnsemblGenomes-Gn; NGR_c26510.
DR   EnsemblGenomes-Gn; NGR_c26520.
DR   EnsemblGenomes-Gn; NGR_c26800.
DR   EnsemblGenomes-Gn; NGR_c27530.
DR   EnsemblGenomes-Gn; NGR_c28030.
DR   EnsemblGenomes-Gn; NGR_c28740.
DR   EnsemblGenomes-Gn; NGR_c28770.
DR   EnsemblGenomes-Gn; NGR_c30310.
DR   EnsemblGenomes-Gn; NGR_c30320.
DR   EnsemblGenomes-Gn; NGR_c30330.
DR   EnsemblGenomes-Gn; NGR_c30340.
DR   EnsemblGenomes-Gn; NGR_c30350.
DR   EnsemblGenomes-Gn; NGR_c30360.
DR   EnsemblGenomes-Gn; NGR_c30490.
DR   EnsemblGenomes-Gn; NGR_c31940.
DR   EnsemblGenomes-Gn; NGR_c34210.
DR   EnsemblGenomes-Gn; NGR_c34220.
DR   EnsemblGenomes-Gn; NGR_c34230.
DR   EnsemblGenomes-Gn; NGR_c34240.
DR   EnsemblGenomes-Gn; NGR_c34260.
DR   EnsemblGenomes-Gn; NGR_c34270.
DR   EnsemblGenomes-Gn; NGR_c35430.
DR   EnsemblGenomes-Gn; NGR_c35810.
DR   EnsemblGenomes-Gn; NGR_c35910.
DR   EnsemblGenomes-Tr; EBT00001553636.
DR   EnsemblGenomes-Tr; EBT00001553637.
DR   EnsemblGenomes-Tr; EBT00001553638.
DR   EnsemblGenomes-Tr; EBT00001553639.
DR   EnsemblGenomes-Tr; EBT00001553640.
DR   EnsemblGenomes-Tr; EBT00001553641.
DR   EnsemblGenomes-Tr; EBT00001553642.
DR   EnsemblGenomes-Tr; EBT00001553643.
DR   EnsemblGenomes-Tr; EBT00001553644.
DR   EnsemblGenomes-Tr; EBT00001553645.
DR   EnsemblGenomes-Tr; EBT00001553646.
DR   EnsemblGenomes-Tr; EBT00001553647.
DR   EnsemblGenomes-Tr; EBT00001553648.
DR   EnsemblGenomes-Tr; EBT00001553649.
DR   EnsemblGenomes-Tr; EBT00001553650.
DR   EnsemblGenomes-Tr; EBT00001553651.
DR   EnsemblGenomes-Tr; EBT00001553652.
DR   EnsemblGenomes-Tr; EBT00001553653.
DR   EnsemblGenomes-Tr; EBT00001553654.
DR   EnsemblGenomes-Tr; EBT00001553655.
DR   EnsemblGenomes-Tr; EBT00001553656.
DR   EnsemblGenomes-Tr; EBT00001553657.
DR   EnsemblGenomes-Tr; EBT00001553658.
DR   EnsemblGenomes-Tr; EBT00001553659.
DR   EnsemblGenomes-Tr; EBT00001553660.
DR   EnsemblGenomes-Tr; EBT00001553661.
DR   EnsemblGenomes-Tr; EBT00001553662.
DR   EnsemblGenomes-Tr; EBT00001553663.
DR   EnsemblGenomes-Tr; EBT00001553664.
DR   EnsemblGenomes-Tr; EBT00001553665.
DR   EnsemblGenomes-Tr; EBT00001553666.
DR   EnsemblGenomes-Tr; EBT00001553667.
DR   EnsemblGenomes-Tr; EBT00001553668.
DR   EnsemblGenomes-Tr; EBT00001553669.
DR   EnsemblGenomes-Tr; EBT00001553670.
DR   EnsemblGenomes-Tr; EBT00001553671.
DR   EnsemblGenomes-Tr; EBT00001553672.
DR   EnsemblGenomes-Tr; EBT00001553673.
DR   EnsemblGenomes-Tr; EBT00001553674.
DR   EnsemblGenomes-Tr; EBT00001553675.
DR   EnsemblGenomes-Tr; EBT00001553677.
DR   EnsemblGenomes-Tr; EBT00001553678.
DR   EnsemblGenomes-Tr; EBT00001553679.
DR   EnsemblGenomes-Tr; EBT00001553680.
DR   EnsemblGenomes-Tr; EBT00001553681.
DR   EnsemblGenomes-Tr; EBT00001553682.
DR   EnsemblGenomes-Tr; EBT00001553683.
DR   EnsemblGenomes-Tr; EBT00001553684.
DR   EnsemblGenomes-Tr; EBT00001553685.
DR   EnsemblGenomes-Tr; EBT00001553686.
DR   EnsemblGenomes-Tr; EBT00001553687.
DR   EnsemblGenomes-Tr; EBT00001553688.
DR   EnsemblGenomes-Tr; EBT00001553689.
DR   EnsemblGenomes-Tr; EBT00001553690.
DR   EnsemblGenomes-Tr; EBT00001553691.
DR   EnsemblGenomes-Tr; EBT00001553692.
DR   EnsemblGenomes-Tr; EBT00001553693.
DR   EnsemblGenomes-Tr; EBT00001553694.
DR   EnsemblGenomes-Tr; EBT00001553695.
DR   EnsemblGenomes-Tr; EBT00001553696.
DR   EnsemblGenomes-Tr; EBT00001553697.
DR   EnsemblGenomes-Tr; EBT00001553698.
DR   EnsemblGenomes-Tr; EBT00001553699.
DR   EnsemblGenomes-Tr; EBT00001553700.
DR   EnsemblGenomes-Tr; EBT00001553701.
DR   EnsemblGenomes-Tr; EBT00001553702.
DR   EnsemblGenomes-Tr; EBT00001553703.
DR   EnsemblGenomes-Tr; EBT00001553704.
DR   EnsemblGenomes-Tr; EBT00001553705.
DR   EnsemblGenomes-Tr; EBT00001553706.
DR   EnsemblGenomes-Tr; EBT00001553707.
DR   EnsemblGenomes-Tr; EBT00001553708.
DR   EnsemblGenomes-Tr; EBT00001553709.
DR   EnsemblGenomes-Tr; EBT00001553710.
DR   EnsemblGenomes-Tr; EBT00001553713.
DR   EnsemblGenomes-Tr; EBT00001553715.
DR   EnsemblGenomes-Tr; EBT00001553717.
DR   EnsemblGenomes-Tr; EBT00001553719.
DR   EnsemblGenomes-Tr; EBT00001553721.
DR   EnsemblGenomes-Tr; EBT00001553723.
DR   EnsemblGenomes-Tr; EBT00001553724.
DR   EnsemblGenomes-Tr; EBT00001553726.
DR   EnsemblGenomes-Tr; EBT00001553729.
DR   EnsemblGenomes-Tr; EBT00001553730.
DR   EnsemblGenomes-Tr; EBT00001553731.
DR   EnsemblGenomes-Tr; EBT00001553733.
DR   EnsemblGenomes-Tr; EBT00001553734.
DR   EnsemblGenomes-Tr; EBT00001553736.
DR   EnsemblGenomes-Tr; EBT00001553737.
DR   EnsemblGenomes-Tr; EBT00001553739.
DR   EnsemblGenomes-Tr; EBT00001553741.
DR   EnsemblGenomes-Tr; NGR_c00890-1.
DR   EnsemblGenomes-Tr; NGR_c01390-1.
DR   EnsemblGenomes-Tr; NGR_c01590-1.
DR   EnsemblGenomes-Tr; NGR_c02200-1.
DR   EnsemblGenomes-Tr; NGR_c02300-1.
DR   EnsemblGenomes-Tr; NGR_c03370-1.
DR   EnsemblGenomes-Tr; NGR_c03710-1.
DR   EnsemblGenomes-Tr; NGR_c05600-1.
DR   EnsemblGenomes-Tr; NGR_c05680-1.
DR   EnsemblGenomes-Tr; NGR_c05730-1.
DR   EnsemblGenomes-Tr; NGR_c08130-1.
DR   EnsemblGenomes-Tr; NGR_c08830-1.
DR   EnsemblGenomes-Tr; NGR_c10070-1.
DR   EnsemblGenomes-Tr; NGR_c10450-1.
DR   EnsemblGenomes-Tr; NGR_c10460-1.
DR   EnsemblGenomes-Tr; NGR_c10470-1.
DR   EnsemblGenomes-Tr; NGR_c11190-1.
DR   EnsemblGenomes-Tr; NGR_c11710-1.
DR   EnsemblGenomes-Tr; NGR_c11720-1.
DR   EnsemblGenomes-Tr; NGR_c11750-1.
DR   EnsemblGenomes-Tr; NGR_c12330-1.
DR   EnsemblGenomes-Tr; NGR_c13130-1.
DR   EnsemblGenomes-Tr; NGR_c13910-1.
DR   EnsemblGenomes-Tr; NGR_c14050-1.
DR   EnsemblGenomes-Tr; NGR_c14060-1.
DR   EnsemblGenomes-Tr; NGR_c14090-1.
DR   EnsemblGenomes-Tr; NGR_c14100-1.
DR   EnsemblGenomes-Tr; NGR_c14150-1.
DR   EnsemblGenomes-Tr; NGR_c14170-1.
DR   EnsemblGenomes-Tr; NGR_c14440-1.
DR   EnsemblGenomes-Tr; NGR_c14840-1.
DR   EnsemblGenomes-Tr; NGR_c15030-1.
DR   EnsemblGenomes-Tr; NGR_c15050-1.
DR   EnsemblGenomes-Tr; NGR_c15080-1.
DR   EnsemblGenomes-Tr; NGR_c15620-1.
DR   EnsemblGenomes-Tr; NGR_c15630-1.
DR   EnsemblGenomes-Tr; NGR_c16110-1.
DR   EnsemblGenomes-Tr; NGR_c19250-1.
DR   EnsemblGenomes-Tr; NGR_c21170-1.
DR   EnsemblGenomes-Tr; NGR_c22590-1.
DR   EnsemblGenomes-Tr; NGR_c23880-1.
DR   EnsemblGenomes-Tr; NGR_c24250-1.
DR   EnsemblGenomes-Tr; NGR_c26470-1.
DR   EnsemblGenomes-Tr; NGR_c26480-1.
DR   EnsemblGenomes-Tr; NGR_c26490-1.
DR   EnsemblGenomes-Tr; NGR_c26500-1.
DR   EnsemblGenomes-Tr; NGR_c26510-1.
DR   EnsemblGenomes-Tr; NGR_c26520-1.
DR   EnsemblGenomes-Tr; NGR_c26800-1.
DR   EnsemblGenomes-Tr; NGR_c27530-1.
DR   EnsemblGenomes-Tr; NGR_c28030-1.
DR   EnsemblGenomes-Tr; NGR_c28740-1.
DR   EnsemblGenomes-Tr; NGR_c28770-1.
DR   EnsemblGenomes-Tr; NGR_c30310-1.
DR   EnsemblGenomes-Tr; NGR_c30320-1.
DR   EnsemblGenomes-Tr; NGR_c30330-1.
DR   EnsemblGenomes-Tr; NGR_c30340-1.
DR   EnsemblGenomes-Tr; NGR_c30350-1.
DR   EnsemblGenomes-Tr; NGR_c30360-1.
DR   EnsemblGenomes-Tr; NGR_c30490-1.
DR   EnsemblGenomes-Tr; NGR_c31940-1.
DR   EnsemblGenomes-Tr; NGR_c34210-1.
DR   EnsemblGenomes-Tr; NGR_c34220-1.
DR   EnsemblGenomes-Tr; NGR_c34230-1.
DR   EnsemblGenomes-Tr; NGR_c34240-1.
DR   EnsemblGenomes-Tr; NGR_c34260-1.
DR   EnsemblGenomes-Tr; NGR_c34270-1.
DR   EnsemblGenomes-Tr; NGR_c35430-1.
DR   EnsemblGenomes-Tr; NGR_c35810-1.
DR   EnsemblGenomes-Tr; NGR_c35910-1.
DR   EuropePMC; PMC2698369; 19376903.
DR   EuropePMC; PMC3133165; 21398532.
DR   EuropePMC; PMC3147472; 21642401.
DR   EuropePMC; PMC3301998; 22419837.
DR   EuropePMC; PMC3553834; 23123907.
DR   EuropePMC; PMC5739047; 29220487.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00518; speF.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF00520; ybhL.
DR   RFAM; RF00521; SAM_alpha.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01998; group-II-D1D4-1.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   SILVA-LSU; CP001389.
DR   SILVA-SSU; CP001389.
DR   StrainInfo; 718579; 0.
XX
CC   Rhizobium sp. NGR234 is available from Prof. Wolfgang Streit,
CC   Biozentrum Klein Flottbek,Mikrobiologie, Ohnhorststr. 18  D-22609
CC   Hamburg, wolfgang.streit@uni-hamburg.de.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3925702
FT                   /organism="Sinorhizobium fredii NGR234"
FT                   /strain="NGR234"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:394"
FT   gene            202..1644
FT                   /gene="dnaA"
FT                   /locus_tag="NGR_c00010"
FT   CDS_pept        202..1644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="NGR_c00010"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00010"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23805"
FT                   /db_xref="GOA:C3MEI2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEI2"
FT                   /protein_id="ACP23805.1"
FT                   /translation="MRHDALFERVSARLKAQVGPDVFASWFGRLKLHSVSKSVVRLSVP
FT                   TTFLKSWINNRYLELITSLFQQEDGEILKVEILVRTATRGQRPAVHEEAVAAAAEPAAA
FT                   APVRRAASPQPVAAAAATVAASAKPVQAPLFGSPLDQRYNFESFVEGSSNRVALAAART
FT                   IAEAGAGAVRFNPLFIHSSVGLGKTHLLQAIALAALQSARAPRVVYLTAEYFMWRFATA
FT                   IRDNDALSLKESLRNIDLLVIDDMQFLQGKSIQHEFCHLLNMLLDSAKQVVVAADRAPW
FT                   ELESLDSRVRSRLQGGVAIEMEGPDYDMRLEMLKRRLDTARQDDTSLDIPQEILSHVAR
FT                   SVTASGRELEGAFNQLLFRRSFEPQLSIERVDELLGHLVNAGEPRRVRIEDIQRIVAKH
FT                   YNVSRQELVSNRRTRVIVKPRQIAMYLSKTLTPRSFPEIGRRFGGRDHTTVLHAVRKIE
FT                   ELISGDTKLSHEIELLKRLINE"
FT   gene            1807..2181
FT                   /locus_tag="NGR_c00020"
FT   CDS_pept        1807..2181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00020"
FT                   /product="hypothetical protein, DGPFAETKE family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00020"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23806"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEI3"
FT                   /protein_id="ACP23806.1"
FT                   /translation="MLYAVLCYNTEDVTSAWTKEQDDKVMRDLTAVQRKYVEAGKLGPV
FT                   ARLLPTTAATTLRHRPGETVVIDGPFAETKEQLLGFYLIDCASLDEALEFARELSAANP
FT                   AAGSYEIRPLSLYKPGELAP"
FT   gene            2178..3452
FT                   /locus_tag="NGR_c00030"
FT   CDS_pept        2178..3452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00030"
FT                   /product="putative RNA polymerase sigma-70 factor"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00030"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23807"
FT                   /db_xref="GOA:C3MEI4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEI4"
FT                   /protein_id="ACP23807.1"
FT                   /translation="MTDTAWIDLALVSARPQAMGALLRYFRNLDLAEEAFQEACIRALK
FT                   TWPTNGPPRDPAAWLIFVGRNSGIDRVRRQSRETALPPEELLSDIEDRESELADRLDGA
FT                   HYRDDILRLLFVCSNPVLPATQQIALALRIVSGLSVKQIARAFLVGEAAMEQRITRAKA
FT                   RVTAAGIPFETPDASERAERLAAVAMMIYLVFNEGYSAMNGPEGVSADLCDEAIRLARL
FT                   LLRLFPAEPEIMGLTALLLLQHSRARARFDAHGAIVLLEDQDRQLWSLPMITEALAMID
FT                   KAMRHRRPGPYQVQAAIAALHARAERSEQTDWEEIELLYRALERLQPSPVVTLNRAVAV
FT                   SKRDGPEAALALVEPLADRLSGYFYFHGLRGGLLKQMGRAREARVAFDRAIALATNAAE
FT                   AAYIRKQLDHLAGEAGASHLHEDQQ"
FT   gene            3527..4009
FT                   /locus_tag="NGR_c00040"
FT   CDS_pept        3527..4009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00040"
FT                   /product="hypothetical protein"
FT                   /note="similar to activator of Hsp90 ATPase 1 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00040"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23808"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEI5"
FT                   /protein_id="ACP23808.1"
FT                   /translation="MTAATDTRPADERDLVLIRLIDAPREKVYRAFTDPELLKQWFAPL
FT                   PWTITEAELDVRPGGTNRFVMRSPEGELYPNQGVYLEVVPNEKLVMSDAYTEAWTPSEK
FT                   PFMTAILTFEEEGGKTRYTARARHWSTADREAHEKMGFHEGWGQCADQLAALVAKL"
FT   gene            4024..4887
FT                   /locus_tag="NGR_c00050"
FT   CDS_pept        4024..4887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00050"
FT                   /product="putative glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00050"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23809"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEI6"
FT                   /protein_id="ACP23809.1"
FT                   /translation="MSTNARTASVADIRAAIEDWAGALRRKDAGRVLSHGTQDCVIYSL
FT                   APPLKASDADPGGLEQWFSTWKGPLGYQLQDLEISSGGDIAFATALAHLSGEKQDGAKV
FT                   SLWYRLTLGLERTDKGWKIAHQHESVPFYMDGSFKAAIDLDPTSQVDWNAPSHPPMAGV
FT                   IAYLNVENADATAKFYGRAFGAREEDRKYAEDGKRLIHCHLTINGGALMLNDPFPEFGF
FT                   PWKPPEGFVLHLIVDDAHAWWERAVAAGAEATMPLEIAFWGDYYGQLRDPFGITWGIVA
FT                   PVKKSN"
FT   gene            5020..5634
FT                   /locus_tag="NGR_c00060"
FT   CDS_pept        5020..5634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00060"
FT                   /product="glutathione S-transferase, N-terminal domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00060"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23810"
FT                   /db_xref="GOA:C3MEI7"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEI7"
FT                   /protein_id="ACP23810.1"
FT                   /translation="MILYYQTHSPFARKALVFAHEIGLADRLEVVHHETSPTRRNDDVY
FT                   AENPLGKVPVLLRSDAEPIFDSDVICAYFDTLHERRKLIPESGEPRWRALRLQSVAQVL
FT                   AQTGIGLRWEWERRPEQLRWPALAKGYEEKIEATYDWLDTTFLPEEDIDVGQIALATTL
FT                   SWMAFRALPSFRDRSRLTRWFDAFEQRASMVATPLSGETQD"
FT   gene            complement(5876..7024)
FT                   /locus_tag="NGR_c00070"
FT   CDS_pept        complement(5876..7024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00070"
FT                   /product="putative oxygen-independent coproporphyrinogen
FT                   III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00070"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23811"
FT                   /db_xref="GOA:C3MEI8"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEI8"
FT                   /protein_id="ACP23811.1"
FT                   /translation="MDPGFGVYVHWPFCAAKCPYCDFNSHVRHQPVDQPRFVAAFLQEM
FT                   ASVGALSGPRTVTSIFMGGGTPSLMEPATVAAILDGIARHWHVPDGIEITMEANPSSVE
FT                   ATRFHGYRAAGVNRVSLGVQALNDRDLKFLGRLHNVEDALKAVRLAREIFPRMSFDLIY
FT                   ARPKQTVEEWERELKEAVSYAVDHLSLYQLTIEEGTPFFGLHKAGKLIVPDGEQSAVLY
FT                   EATQEITAAIGMPAYEVSNHARRGAESRHNLTYWRYGDYAGIGPGAHGRLTAGSGKIAT
FT                   ATERNPEAWLRLVEERGDGITEQEPLDREAQADELLLMGLRLREGVDLARWQGLSGRDP
FT                   DPEREQFLIEHGFVERLGNSRLRCTPAGMLILDAVVADLACP"
FT   gene            complement(7071..7715)
FT                   /locus_tag="NGR_c00080"
FT   CDS_pept        complement(7071..7715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00080"
FT                   /product="Ham1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00080"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23812"
FT                   /db_xref="GOA:C3MEI9"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEI9"
FT                   /protein_id="ACP23812.1"
FT                   /translation="MRKLVDKTLVVASHNAGKIREIRDLIGPLGFEAKSAADLNFVEPD
FT                   ETGTTFEENATIKALASARASGLPALSDDSGLAIDALGGAPGVYTANWAERDDGSRDFA
FT                   MAMEKVERELSEKGATKPEERTARFVSVLCLAWPDGHVELFRGEVEGHVVWPPRGTSGF
FT                   GYDPVFQPTGYDTTFGEMSAEEKHGWKPGNSEALSHRARAFKLFAETCLGA"
FT   gene            complement(7749..8258)
FT                   /locus_tag="NGR_c00090"
FT   CDS_pept        complement(7749..8258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00090"
FT                   /product="predicted glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00090"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23813"
FT                   /db_xref="GOA:C3MEJ0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEJ0"
FT                   /protein_id="ACP23813.1"
FT                   /translation="MPNSSRCRSRRSPARACGRFAPWHCKLRGTTLAAALEGILETALY
FT                   ADDLDAAEAFYGNVLGLARITRVGNRHVFFRCGDGVLLIFNAAETVKPPAAGALPVPSH
FT                   GTQGKGHMCFRVGAPALEAWKAKLEAAGVAIEADIRWPNGARSFYFRDPAGNSLECAEP
FT                   GLWDID"
FT   gene            complement(8215..8934)
FT                   /locus_tag="NGR_c00100"
FT   CDS_pept        complement(8215..8934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00100"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00100"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23814"
FT                   /db_xref="GOA:C3MEJ1"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MEJ1"
FT                   /protein_id="ACP23814.1"
FT                   /translation="MRPSGRKTDQMRKVSFERNFSKHAEGSCLVRFGDTHVLCTASLED
FT                   KVPAWLRNGGKGWITAEYGMLPRATGERMRREASTGKQSGRTQEIQRLIGRSLRAVVDL
FT                   PALGERQISIDCDVIQADGGTRTASITGAWIALHDCLKWMEARNMIKVERVLKDHVAAI
FT                   SCGIFANQAVVDLDYLEDSAAETDANFVMTGSGGLVEIQGTAEGKPFSEEEFASLMQLA
FT                   KDGIAELVALQKQAVAG"
FT   gene            9093..10172
FT                   /gene="hrcA"
FT                   /locus_tag="NGR_c00110"
FT   CDS_pept        9093..10172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="NGR_c00110"
FT                   /product="heat-inducible transcription repressor, HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00110"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23815"
FT                   /db_xref="GOA:C3MEJ2"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MEJ2"
FT                   /protein_id="ACP23815.1"
FT                   /translation="MVLRNPEKKGIASTLDERSGEIFRRIVETYLESGEPLGSRNLSRL
FT                   LPMSLSPASVRNVMSDLEDLGLIYSPHVSAGRLPTQTGLRFFVDAFMQVGNLSAEERTS
FT                   IERQVRRADRDQPIDSLLAEASQMLSGMSRGAGLVITTKSDPVLKHVEFIRLAPTKALA
FT                   VLVGDHDQVENRIIELPAGITSAQLTEAANFVNAHLAGQTIPELRSQLEKVKETVRGEL
FT                   DALSQDLVERGLAIWSGSEGDEKPARLIVRGRANLLEGLEGTEDIERLRMLFDDLEKKD
FT                   SLIELLDLAESGPGVRIFIGSENKLFSLSGSSLIVAPYRDSDDRIVGAVGVIGPTRLNY
FT                   SRIVPMVDYTAQLMSRLSR"
FT   gene            10288..10956
FT                   /gene="grpE"
FT                   /locus_tag="NGR_c00120"
FT   CDS_pept        10288..10956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="NGR_c00120"
FT                   /product="GrpE protein"
FT                   /note="nucleotide exchange factor"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00120"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23816"
FT                   /db_xref="GOA:C3MEJ3"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEJ3"
FT                   /protein_id="ACP23816.1"
FT                   /translation="MMPNTPKTRHSENVMTDETNKNGTEAAAPEEIVKATGPEAAEKPE
FT                   AGASAAGPDPLELAKAESADLRDKYLRLAAEMDNLRRRTERDVKDAKSYSVAGFARDML
FT                   AVSDNLRRALEAIPAEARESGDAGLTALIEGVEMTERSMLAALERHGVKQLDPTGQRFD
FT                   PNFHQAMFEVPNPEVPNNTVVQVVQAGYTIGERVLRPAMVGVAKGGPKIVAAESETPAA
FT                   "
FT   gene            complement(11264..12499)
FT                   /locus_tag="NGR_c00130"
FT   CDS_pept        complement(11264..12499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00130"
FT                   /product="FAD-linked oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00130"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23817"
FT                   /db_xref="GOA:C3MEJ4"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEJ4"
FT                   /protein_id="ACP23817.1"
FT                   /translation="MLQAGGHWRNWVGNQSCIVRHRGAPESEAELAEMVREATSAGLNV
FT                   RCAGSGHSFTPVALTSGLHLTLSGMLGVANIDQARKRVSVSAGTTINQLGKALKSNGLS
FT                   LINQGDIDSQALAGALTTGTHGTGAALGNMASQIVGMRLVQPDGSILVVDEMTPDLLEA
FT                   ARVSVGMLGVISEITLQVMDSYNLHEKLWRCDFDECMEQHDELAAKHRHFGFFWCPVPE
FT                   SRHCYCLPDTSSVSTTEKTADVCEMKVIDITDRPPTEGTFERIAYSSEIYPIEYVPNFH
FT                   ELEYAVPVAHGKEAVKAVRKLMLEKHPTCIYPIEYRFTAGDSGWISPFYEQDSITLSVS
FT                   GEPGTDYWEYLKDVDTILRQYGSRPHWGKLHFLGAEDVTALYPRSADFRALRAKVDPEG
FT                   RFLNDHLRQLFA"
FT   gene            complement(12512..13279)
FT                   /locus_tag="NGR_c00140"
FT   CDS_pept        complement(12512..13279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00140"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00140"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23818"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEJ5"
FT                   /protein_id="ACP23818.1"
FT                   /translation="MTGRLSGKVALISGGAGGCGLAASELFAREGAKVGIVDLPKSKGE
FT                   DVAAAIRAAGGEAVFAAADVSISTEVSAAVRTVEDAFGPITVLFNHAGILAVGPFLETE
FT                   EAEWDRLMAVNVKSMFLMTKAVLPGMLRAGGGSIVCTSSISAVAATPMEVLYDTTKGAC
FT                   HMFARAIAVEFRDRNIRCNAVCPGFIATDHGKRELVGLTKYGVDVSEAAIAAQQGRMCD
FT                   PMEVANAALFLASDESSFVNGTHLFVDNCFTAV"
FT   gene            complement(13463..13927)
FT                   /locus_tag="NGR_c00150"
FT   CDS_pept        complement(13463..13927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00150"
FT                   /product="predicted phosphotransferase system,
FT                   phosphoenolpyruvate-dependent sugar EIIA 2"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00150"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23819"
FT                   /db_xref="GOA:C3MEJ6"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR006320"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEJ6"
FT                   /protein_id="ACP23819.1"
FT                   /translation="MALAGLLHQNAIIPAMRANSKKQLLLELAAKASKLTGLPEREIFD
FT                   VILQRERLGSTGVGNGIAIPHGKLGNLSSLVGIFARLDTPVDFEALDDQPVDLVFLLLA
FT                   PEGAGADHLKALSRIARVLRDHDMVTRIRATDSASAIYMLLNEDTTSHAA"
FT   gene            complement(14101..14673)
FT                   /locus_tag="NGR_c00160"
FT   CDS_pept        complement(14101..14673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00160"
FT                   /product="ribosomal protein S30Ae/sigma 54 modulation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00160"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23820"
FT                   /db_xref="GOA:C3MEJ7"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEJ7"
FT                   /protein_id="ACP23820.1"
FT                   /translation="MSVRVSGKHMEIGESFRSRIGEQIREAVAKYFDGGYSSQVTVEKS
FT                   GSRFSADCKLHLDTGVVLQANGQANEPQAAFDAASDRIEKRLRRYKRKLKDHHNGNGQN
FT                   AAEVAYRVMDSVPFEDEEVPDDYAPTIVAESTKQLRTMSVANAVMALDMTDEPVLMFRS
FT                   PGKDDLNIVYRRNDGNIGWIDAANIKG"
FT   gene            complement(14864..16423)
FT                   /locus_tag="NGR_c00170"
FT   CDS_pept        complement(14864..16423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00170"
FT                   /product="RNA polymerase sigma-54 factor"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00170"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23821"
FT                   /db_xref="GOA:P22881"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22881"
FT                   /protein_id="ACP23821.1"
FT                   /translation="MALSASLHLRQSQSLVMTPQLMQSIQLLQMTHLELGQFIAQEVEK
FT                   NPLLEFQSADEAGFGSDRPERDETGLTAEAGGAEESVDHGDLYDSATTSPGERLSTELD
FT                   ADFANVFQDDTAPQRADAPELLGQWKSMPGAGGSNDGEGYDLDDFVAGRKTLRETLIEQ
FT                   VAFAFAAPADRLIAQHLIDQLDEAGYLHAEIAETAARLGASAADVTRVLLVLQQFDPPG
FT                   VFARTLSECLAIQLRLRNRLDPAMEALVANLELLARRDFASLKKICGVDEEDLIEMLAE
FT                   IRKLDPKPGTSFETSVTEAIIPDVVVRSAPDGGWLVELNPDALPRVLVNHDYFAEISRH
FT                   SQKNSAEQAFLSECMQNANWLTRSLDQRARTILKVASEIVRQQDAFLVHGVDHLRPLNL
FT                   RIVADAIKMHESTVSRVTSNKYILTPRGLFELKYFFTVSIGSAENGDAHSAESVRHRIR
FT                   TMISQESADAVLSDDDIVDILKRAGVDIARRTVAKYREAMNIPSSVQRRREKRALAKAA
FT                   GF"
FT   gene            complement(16666..17493)
FT                   /locus_tag="NGR_c00180"
FT   CDS_pept        complement(16666..17493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00180"
FT                   /product="predicted ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00180"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23822"
FT                   /db_xref="GOA:C3MEJ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEJ9"
FT                   /protein_id="ACP23822.1"
FT                   /translation="MQDSDVQIPFLPKRKRVKKPSAAAVAARTVDKARYDGTLIARGLT
FT                   KSYRSRRVVNGVSLVVRRGEAVGLLGPNGAGKTTCFYMITGLVPVDEGSIEINGNDVTT
FT                   MPMYRRARLGVGYLPQEASILRGLTVEENIRAVLEIHDKNVDRRESKLNDLLGEFSITH
FT                   LRKSPAIALSGGERRRLEIARALATDPTFMLLDEPFAGVDPISVADIQALVRHLTSRGI
FT                   GVLITDHNVRETLGLIDRAYIIHAGEVLTHGRANDIVTNPDVRRLYLGDNFSL"
FT   gene            complement(17493..18056)
FT                   /locus_tag="NGR_c00190"
FT   CDS_pept        complement(17493..18056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00190"
FT                   /product="putative OstA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00190"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23823"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEK0"
FT                   /protein_id="ACP23823.1"
FT                   /translation="MSVTSTVSFKVSASLAAAGIGALIIASGALAQATSSRMKGMQLSN
FT                   DQPIQIESDKLEIKDPESKAIFTGNVKVVQGTTTLQAGNMTVFYKATEGATITSGNADI
FT                   DRIEVNNKVFLSSGAQQATGDTGLVNLTNQTIVLKGDKVVLSEGKNVFVGCQLNVQMDT
FT                   GEAQLEACGGRVQIQLDPQSRKQN"
FT   gene            complement(18073..18792)
FT                   /locus_tag="NGR_c00200"
FT   CDS_pept        complement(18073..18792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00200"
FT                   /product="hypothetical protein, putative transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00200"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23824"
FT                   /db_xref="GOA:C3MEK1"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEK1"
FT                   /protein_id="ACP23824.1"
FT                   /translation="MRILQISQEPNGTDGPLMLNQARYPDILADSGTSPADAYASAARH
FT                   SARVKRLKIVLPFAAGVIALVFAAISFVRAFLPEDLQLETATIENGKIVMQNPAISGRN
FT                   RQDISYSMKAQRALQDIANPDIITLEQIHAEMPVNDTLVATVDATSGIYDRGANTLDMN
FT                   APFTISMNNGVNADFQSAYLDIDAGEMETKHPIAISMNGGSIIAQSLRMTDKGRIVTFE
FT                   GMVRVNVEPSAIRKNAK"
FT   gene            19002..19961
FT                   /gene="sppA"
FT                   /locus_tag="NGR_c00210"
FT   CDS_pept        19002..19961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sppA"
FT                   /locus_tag="NGR_c00210"
FT                   /product="signal peptide peptidase S49, SppA"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00210"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23825"
FT                   /db_xref="GOA:C3MEK2"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEK2"
FT                   /protein_id="ACP23825.1"
FT                   /translation="MDELAIADRRSLRRKLSFWRWTAAAILVLGGFALIAFSGWTEVSE
FT                   RAREHVARVTVSGVIQDDRELVERLERIADNKSAKALIVTISSPGGTTYGGEVLYKAIR
FT                   KVAAKKPVVSDVRTLAASAGYMIALAGDRIVAGETSITGSIGVIFQYPQVKQLMDKVGV
FT                   SLESIKSRPLKAEPSPFHPPSPEARAMIQTMIDDSYNWFVDLVAERRKLPRPEALALAD
FT                   GRIFTGRQALQGKLVDTIGGDDEIRAFLADRKVSKDLPVVDWEAPGGSFPFGLSTVVSN
FT                   WLKLLGYDAFPAMNGLEKIGGDKLFLDGLVSVWQVDAQ"
FT   gene            20006..20383
FT                   /locus_tag="NGR_c00220"
FT   CDS_pept        20006..20383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00220"
FT                   /product="integration host factor, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00220"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23826"
FT                   /db_xref="GOA:C3MEK3"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEK3"
FT                   /protein_id="ACP23826.1"
FT                   /translation="MFRASGATFQASQADRKSKKTKGAKVIKSELVQIVAARNPHLYHR
FT                   DVENIVNAVLDEITDALAAGNRVELRGFGAFSVKNRPSRSGRNPRTGDSVFVEEKWVPF
FT                   FKTGKELRERLNPGMNDRDDD"
FT   gene            20500..20841
FT                   /locus_tag="NGR_c00230"
FT   CDS_pept        20500..20841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00230"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00230"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23827"
FT                   /db_xref="GOA:C3MEK4"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEK4"
FT                   /protein_id="ACP23827.1"
FT                   /translation="MFKKIVNIVVLVPLGVILIALSVANRQTVTLALNPFDTADSVLSV
FT                   SAPFFLFLFLAVVVGLVLGAAAVWLSQGKYRRRARSEAHEALKWHREAEKHRSEAERLS
FT                   QVNLPAPQN"
FT   gene            complement(20887..21345)
FT                   /locus_tag="NGR_c00240"
FT   CDS_pept        complement(20887..21345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00240"
FT                   /product="predicted carbon monoxide dehydrogenase subunit
FT                   G"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00240"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23828"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEK5"
FT                   /protein_id="ACP23828.1"
FT                   /translation="MDITGEERIAARREAVWQCLNDPDILKRCIPGCQAVEAVSPTELT
FT                   AVVKVKIGPVSATFNGKVTLSNLNPPESYTISGEGKGGIAGFAKGGADVTLAEESDETL
FT                   LSYDVKAEVGGKLAQLGSRLIDSTAKKLAQQFFANLNLAVSGAAEAAS"
FT   gene            21597..22739
FT                   /locus_tag="NGR_c00250"
FT   CDS_pept        21597..22739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00250"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23829"
FT                   /db_xref="GOA:C3MEK6"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEK6"
FT                   /protein_id="ACP23829.1"
FT                   /translation="MKEKDRRSKNASVTAAKGRGAEARGGRHEPRHPSAKSGAPKGKAG
FT                   GLPSPKAAAQKSPRSAAQESTPARSIEPRSGEKPAETVPLILETVPTAGYHLIDSGDGE
FT                   KLEQYGPYRIVRPEAQALWPKALPAAVWEKADAIFTGDTDEDGMGRWRFPREALGETWP
FT                   MQLLDTDFLGRFTSFRHVGVFPEQLAHWSWMKDQVAASGRPLKVLNLFGYTGVASLVAA
FT                   KAGAEVTHVDASKKAIGWARENQAMARAEKLPIRWICDDAMKFIQREERRGSRYDIILT
FT                   DPPKFGRGPNGEVWQLFDHLAAMLDICREILSPDARGLVLTAYSIRASFYSIHELMRET
FT                   MRGRGGRVESGELIIREGGLDGKAPGRALSTSLFSRWVPK"
FT   gene            22736..23593
FT                   /gene="spoU"
FT                   /locus_tag="NGR_c00260"
FT   CDS_pept        22736..23593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spoU"
FT                   /locus_tag="NGR_c00260"
FT                   /product="tRNA/rRNA methyltransferase SpoU"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00260"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23830"
FT                   /db_xref="GOA:C3MEK7"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEK7"
FT                   /protein_id="ACP23830.1"
FT                   /translation="MNSDRSDHGTPRVGQVKEVTSLTNPIVKDIRALAQKKHRDETRSF
FT                   MAEGLKLVIDALDLGWKIKTLVYAKAAKGKPQVGQVAAKAVARGGLVLEVSEKVISTIT
FT                   RRDNPQMVVGIFEQRYQPLKDIRPGEGETYVALDRVRDPGNLGTIIRTADAAGASGIIL
FT                   VGETTDPFSLETVRATMGSVFAMPVARASAEDFLRWQRSAGVQVVATHLSGSVDYRTID
FT                   YRSKPVVLLMGNEQAGLPAELAREAGALARIPQAGRADSLNLAIATGIMLFEARRHLLS
FT                   LDAP"
FT   gene            23593..24093
FT                   /locus_tag="NGR_c00270"
FT   CDS_pept        23593..24093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00270"
FT                   /product="lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00270"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23831"
FT                   /db_xref="GOA:C3MEK8"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MEK8"
FT                   /protein_id="ACP23831.1"
FT                   /translation="MSERNTLFSRPLPIALFILVALVADQAIKYLVEAFLPFQEAVPVV
FT                   PMLALYRTYNYGVAFSMLSGMEGWFIVGMRLAVVAFVLWLWRRTPKDRFFAHLGYAMII
FT                   AGALGNLVDRLLFGYVIDYILFHTATWSFAVFNLADSFITVGAGAIILDELLQTKKTRS
FT                   LKL"
FT   gene            24140..26407
FT                   /locus_tag="NGR_c00280"
FT   CDS_pept        24140..26407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00280"
FT                   /product="sensor protein"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00280"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23832"
FT                   /db_xref="GOA:C3MEK9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEK9"
FT                   /protein_id="ACP23832.1"
FT                   /translation="MSEPFSAQQRKQAGPGAMPAAVDVARSATAMAGRPPPVARRSPVD
FT                   RETSVGHILLAVAGLAAAALLLVAGARAGLHLLPAVAAVGALAGAFLLLSREGAASRQA
FT                   SEPGSGADRTERCSETAKLLSTIHDALGDIALVRGMDGKIVQANAVFSRVCGRVDVRGL
FT                   TCASLGLSFEPRPDPDRFIVRFATPAGLRLYDWHDVVIREPASGRLMRHSIARDVTEEA
FT                   QAVRRGEEARLRAEEASQAKSRLLATVTHEIRTPLSGILGMSHLLAQTQLSAEQRNYLA
FT                   DMQQSGHALVQLVEDLIDFSSLSAGRFQLHPSEQELRLVIENVVEMLSHRAHEKGIEIG
FT                   VAIDASVPPRFGFDAARLRQVLFNVIGNAVKFTEAGGVLVTADYGEGHVRIRVDDSGPG
FT                   MSADELARVFEEFEQAGDHAQRSKGTGLGLAISRRIMEAFGGSLIASSVTGEGSRFEIR
FT                   FPVDEALSAAQPRRGALADAHVLLLAPDGPASMALAATIKTLGGQCHRAPTLSAAREVI
FT                   ARPLAGALPLTDIIVDHRHASQLRQLLLLEPALERQRLRKTCLISPEERSSHPVNRMGG
FT                   YEAWLIRPLREKSLVEVLLGRMTGIEKRDGINDNRPILRAEPRKAAAVSPDRRRVLLAE
FT                   DDPVNALVLRKMLERAGHGVDHVGDFAALEAALQGRAAPGLIVTDFNMPGGDGLALLRR
FT                   LRGVEAAGKGNRVPVVVLTSDVRSDLHRLLLAAGADAVLTKPAEPERFLAEVARLLDAG
FT                   QA"
FT   gene            26505..27395
FT                   /locus_tag="NGR_c00290"
FT   CDS_pept        26505..27395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00290"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23833"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEZ6"
FT                   /protein_id="ACP23833.1"
FT                   /translation="MTIDLLDSTSVVDTSQVRSRKTIAAPATDVLGRIANLETRLARTA
FT                   AEIDAAQAVRYRVFVEEMKAQVTPEAERRKRDVDGWDAICDHLLVLDTSIEGDAEEQIV
FT                   GTYRLLRQEVAARAGGFYSASEFAIDDLLARHPDKRFMELGRSCVLPEYRTKRTVELLW
FT                   QGNWAYALKHGIDAMFGCGSLPGVVPEEHALALSFLHHNLLARDQWAVAARPELYRTMD
FT                   LMPPEAINPKKALAALPPLIKGYMRLGAMVGDGAVVDHAFRTTDVLIVLPISNISGRYL
FT                   NYYGADAGRFSSSVS"
FT   gene            complement(27793..30078)
FT                   /locus_tag="NGR_c00300"
FT   CDS_pept        complement(27793..30078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00300"
FT                   /product="NADP-dependent malic enzyme"
FT                   /EC_number="1.1.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00300"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23834"
FT                   /db_xref="GOA:C3MEZ7"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEZ7"
FT                   /protein_id="ACP23834.1"
FT                   /translation="MPATDKTDRTMTSVTAQEALDFHSQGRPGKLEISPTKPMATQRDL
FT                   SLAYSPGVAVPVKAIAEDPATAYDYTARGNMVAVISNGTAILGLGNLGALASKPVMEGK
FT                   SVLFKRFADVDSIDLEVDTENVDEFINCVRFLGPSFGGINLEDIKAPDCFIIEQRLREV
FT                   MDIPVFHDDQHGTAIIAAAGLINALALTGRDFKTTKLVCNGAGAAAIACIELIKAMGFN
FT                   PENIILCDTKGVIFQGRTEGMNQWKSAHAVKTDRRTLAEAVEGSDVFFGLSAKGALSPE
FT                   MVRSMAARPIIFAMANPDPEITPEEVAQIRDDAIVATGRSDYPNQVNNVLGFPYIFRGA
FT                   LDVRASTINDAMKIAAAEALASLAKEDVPDDVAAAYQGNRPRFGPQYIIPVPFDPRLIS
FT                   AIPMAVAKAAMETGVAQKPIADLNAYGQQLSARRDPIASTLQRIFERVRRQPKRIVFAE
FT                   GEEVQMMRSAIAYANQQLGTAILLGREEQMRETAEREGIDLDRPGIQIVNARLSKRVSA
FT                   YTDFLYARLQRKGYLFRDVQRLINNDRNHFAASMVALGDADGMVTGLTRNYSTALEDVR
FT                   RCIDAKPGHRVIGVSIALCRGRTVLVADTAVHDMPSAEELADIAEEAAGLAKRLGYMPR
FT                   VAMLAYSTFGHPSGERSERVREAVKILDRRRVDFEYDGEMAADVALNHRVLEQYPFCRL
FT                   SGTANVLVMPAFHSASISTKMLQELGGSTVIGPLLVGFDKSVQITSMSAKDSDIVNLAA
FT                   IAAYNAGT"
FT   gene            30127..32928
FT                   /gene="mutS"
FT                   /locus_tag="NGR_c00310"
FT   CDS_pept        30127..32928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="NGR_c00310"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00310"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23835"
FT                   /db_xref="GOA:C3MEZ8"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEZ8"
FT                   /protein_id="ACP23835.1"
FT                   /translation="MSSINACGYCDISFFGTIMNFVSDASSRTGDVLSVSDLASEESRS
FT                   TATPMMEQFIEIKANNPDSLLFYRMGDFYELFFQDAVEASRALGITLTKRGQHLGQDIP
FT                   MCGVPVHAADDYLQKLIALGFRVAVCEQVEDPAEAKKRGSKSVVRRDVVRLVTPGTITE
FT                   DKLLSPSESNYLMALARIRSGSEPAYALAWIDISTGIFRLAETAESRLLADILRVEPRE
FT                   LILPDTVFHDPELRPVFDVLGRVAVPQPAVLFDSATAEGRIARYYGVKTLDGFGTFSRA
FT                   ELAAASAAISYVEKTQIQERPALGIPERESAASTLFIDPATRANLELVKTLSGAREGTL
FT                   LRALDRTVTSGGARLLAERLMSPLTDPDRINQRLDSIEVLLDQPSFAIDVRDTLRRAPD
FT                   MPRALSRLALGRGGPRDLGAIQAGLRAAAATATLLSGARLSEELTEAHAAIAALPAALL
FT                   ARLDSMLAEDLPLLKRDGGFLREAASGELDEMRALRDQSRRVIAGLQLQYCEETGIKSL
FT                   KIKHNNVLGYFIEVTAGNAGAMTDTDAGRARFIHRQTMASAMRFTTTELAELETKIANA
FT                   ADRALAIELEAFEAMAREVVADAEAIKAASLALAMLDVSAGLAVLAEEQNYARPAVDRS
FT                   RMFLIDGGRHPVVEQALRRQAGNPFVANGCDLSPPDGPEAGAIWLLTGPNMGGKSTFLR
FT                   QNALIAIMAQMGSFVPANAAHIGIVDRLFSRVGASDDLARGRSTFMVEMVETAAILNQA
FT                   TDHSLVILDEIGRGTATFDGLSIAWAAVEHLHEVNRCRGLFATHFHELTVLSEKLGRLS
FT                   NATMRVKEWDGDVIFLHEVGPGAADRSYGIQVARLAGLPASVVARARDVLANLEDADRK
FT                   NPASQLIDDLPLFQVAVRREEVARASGPSRAEEALRAINPDDMTPREALEALYALKKDL
FT                   AGR"
FT   gene            33204..36101
FT                   /gene="glnD"
FT                   /locus_tag="NGR_c00320"
FT   CDS_pept        33204..36101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="NGR_c00320"
FT                   /product="[Protein-PII] uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00320"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23836"
FT                   /db_xref="GOA:C3MEZ9"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEZ9"
FT                   /protein_id="ACP23836.1"
FT                   /translation="MQRTIRSVGQDASRHFMARHETSFPEILDVAALRAKCGFIAAAHA
FT                   EQREPMRRALLAAFKEANNAGRAKARQLLAADGAGIKCAERISWLQDQLITVLHDFMLN
FT                   EVFDAAHAPPAARLAVTAVGGYGRGTLAPGSDIDLLFLLPSKRAVWAEPAIEFMLYVLW
FT                   DLGFKVGHATRTIDECIRLSRADMTIRTAILECRYICGSEALAGELEQRFDHEIVRNTG
FT                   PEFIAAKLAERDGRHRKAGDTRYLVEPNVKEGKGGLRDLHTLFWIAKYFYRVKDPADLV
FT                   KLAVLSRQEYKLFQKSDDFLWAVRCHMHFLTGKAEERLSFDIQREIAEALGYHDHPGLS
FT                   AVERFMKHYFLVAKDVGDLTRIFCAALEDQQAKDTPGISGVFSRFKHRTRKIAGTLDFV
FT                   DDGGRIALASPDVFKREPINLLRLFHIADIHGLEFHPNALKQVTRSLGLITPHLRENDE
FT                   ANRLFLSILTSRRNPELILRRMNEAGVLGRFIPDFGKIVSMMQFNMYHHYTVDEHLLRT
FT                   VDVLSRIDRGLEEEAHPLTAMLMPGIEDRSALYVAVLLHDIAKGRPEDHSVAGAKVARK
FT                   LCPRLGLSPKQTETVVWLVEEHLTMSMVAQTRDLNDRKTILDFAERVQSLDRLKMLLIL
FT                   TVCDIRAVGPGVWNGWKGQLLRTLYYETELLLSGGFSELSRKERAKHAAHMLSDALKDW
FT                   SKKERDAYVRLHYQPYLLTVALEDQVRHAEFIREADRAGKTLATMVRTHHFHAITEITV
FT                   LSPDHPRLLTVIAGACAAAGANIVDAQIHTTSDGRALDTILVNREFSVDEDEMRRAASI
FT                   GKLIEDVLSGRKRLPEVIASRTRAKKRSKAFTVTPEVTISNTLSNKFTVIEVEGLDRTG
FT                   LLSEITAVLSDLSLDIASAHITTFGEKVIDTFYVTDLVGAKITNENRQGNIAARLKAVL
FT                   AGEVDEARERMPSGIIAPAHSPRSSHAARTTKVET"
FT   gene            36098..37705
FT                   /gene="mviN"
FT                   /locus_tag="NGR_c00330"
FT   CDS_pept        36098..37705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="NGR_c00330"
FT                   /product="integral membrane protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00330"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23837"
FT                   /db_xref="GOA:C3MF00"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF00"
FT                   /protein_id="ACP23837.1"
FT                   /translation="MSLVKKFATVGGATLGSRVFGFVRETFMAAALGTGPVADAFNTAF
FT                   RLPNTFRRLFAEGAFNAAFVPLFAKEIEARGMEGARRFSEEVFGVLFTVLLFLTIAMEL
FT                   AMPFIVRELIAPGFADDPAKFASTVTFATIMFPYLACMSLAAMMAGMLNSLHRYFAAAI
FT                   APVFLNVILIGVLAYAWYSGQDPVAVGYGLSWGVMAAGLVQLAIVWIAVRNAGIKIGFR
FT                   RPRLTANVRRLLVLALPAAITGGITQINLLINTNIASAQEGAVSSLVYADRIYQLPLGV
FT                   VGIAVATVLLPELSRALRGGNLNEAANLQNRSVEFTLFLTLPAAAALLVMSEPIVRLLF
FT                   ERGKFSPEATVVVGHILAIYGLGLPAFVLIKAFIPGFFAREDTRTPMIFAAISVVVNVS
FT                   LAVTLFPPLGASGIATAEIVAGWVNALLLFTTLLWRGHWGRDIPLLTRVPRLVIAAAIM
FT                   AAALHYAIEWLAFPLSSAAPLAVRAATVCGLVAAAMAIYFASAFGLGGASLGMIRRSLK
FT                   RRAAPAAAPTTGEGPDSP"
FT   gene            37702..38094
FT                   /locus_tag="NGR_c00340"
FT   CDS_pept        37702..38094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00340"
FT                   /product="predicted glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00340"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23838"
FT                   /db_xref="GOA:C3MF01"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF01"
FT                   /protein_id="ACP23838.1"
FT                   /translation="MKQTIARIAILVPDYDEGLAFYCGRLGFELIEDTDLGAGKRWVLV
FT                   RPTGATETALLIAKAEGERQNAAIGNQAGGRVGFFLFTDDFARDHAAMLAAGVEFLEPP
FT                   RHEAYGTVAVFTDPFGNRWDLLQPAS"
FT   gene            38169..39233
FT                   /gene="trpS"
FT                   /locus_tag="NGR_c00350"
FT   CDS_pept        38169..39233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="NGR_c00350"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00350"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23839"
FT                   /db_xref="GOA:C3MF02"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF02"
FT                   /protein_id="ACP23839.1"
FT                   /translation="MNEFKPLVFSGVQPTGNLHLGNYLGAIRKFVALQENNDCIYCVVD
FT                   LHSITAQLVHEDLPGQIRSIAAAFVASGIDPEKHIVFNQSAVPQHAELAWIFNCVARIG
FT                   WMNRMTQFKDKAGKDRENASLGLLAYPSLMAADILVYRATHVPVGDDQKQHLELTRDIA
FT                   QKFNIDFMEHIRARGCGVDIVVGEEPIHAYFPPVEPLIGGPAPRVMSLRDGTKKMSKSD
FT                   PSDLSRINLMDDAETIAKKIRKAKTDPDALPSEVEGLQGRPEAENLVGIYAALSDRTKQ
FT                   EVLAEFGGQQFSVFKPALIDLAVDVLSPITGEMRRLMDDTAHIDAILRSGGERARARAE
FT                   KTMREVREIIGFLQ"
FT   gene            39262..39777
FT                   /locus_tag="NGR_c00360"
FT   CDS_pept        39262..39777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00360"
FT                   /product="predicted universal stress protein UspA"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00360"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23840"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF03"
FT                   /protein_id="ACP23840.1"
FT                   /translation="MRRCNVRRMVSTRLSRLEGHRRKFMAVIDDTPECGRAVHYAGMRA
FT                   KNSNGGLVLLYVIADGDFQQWLGVEEIMRAEAREEAEATLAKVAQTVRERIGIEPEIVI
FT                   REGIATDQIYALIEEDRDIAILVLAAGSAKEGPGPLVSSIAGKAAAFPIPVTVIPDLLT
FT                   DEEIDALS"
FT   gene            39885..40451
FT                   /locus_tag="NGR_c00370"
FT   CDS_pept        39885..40451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00370"
FT                   /product="putative scaffold protein Nfu/NifU"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00370"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23841"
FT                   /db_xref="GOA:C3MF04"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF04"
FT                   /protein_id="ACP23841.1"
FT                   /translation="MFIQTEATPNPATLKFLPGKVVMENGTAEFRSEEEARTGSPLAAR
FT                   LFSIPGVSGVYFGYDFITVSKEGQEWQHLKPAVLGSIMEHFMSGQPIMSGASRAEETDQ
FT                   EGEFYDEGDEAIVATIKELLDTRVRPAVAQDGGDITFRGFKDGTVFLNMKGACSGCPSS
FT                   TATLRHGVQNLLRHFVPEVESVESV"
FT   gene            40678..41340
FT                   /locus_tag="NGR_c00380"
FT   CDS_pept        40678..41340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00380"
FT                   /product="putative peptidase M22, glycoprotease"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00380"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23842"
FT                   /db_xref="GOA:C3MF05"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF05"
FT                   /protein_id="ACP23842.1"
FT                   /translation="MLVLAIDTSGSGCAAAVYDGAAGEVLARAGADIGRGHAERLMDFV
FT                   DEALIASDRQLAEIDRIAVTVGPGSFTGIRVGVAAVRGLALALGKPALGITTLRVVAES
FT                   ARQKQPGRPVLAAIDAKRDEIYVQSFTARGEAEGEPEILPVAEARDRFSGFDGIICGSG
FT                   ASLVASTEPVGRPDEIDIAVVARLGAAADPASAKPKPLYLRGPDAKPQSGFAVARAG"
FT   gene            41673..42170
FT                   /locus_tag="NGR_c00390"
FT   CDS_pept        41673..42170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00390"
FT                   /product="predicted ribosomal-protein-alanine
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00390"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23843"
FT                   /db_xref="GOA:C3MF06"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF06"
FT                   /protein_id="ACP23843.1"
FT                   /translation="MSFTDYFTRRTEFDIFPLEEIDLLAAAALHSQRFATPWSDGEIHA
FT                   LLLQDAVFGFAARQTNGAFRPALGGFVLSRAAAGEAEILTIGVDSRFARSGLGWRLMQA
FT                   AMREAIVKGAETLFLEVDETNLAAIGLYGKLGFARVGERKAYYKGTAGARTAALVMRLD
FT                   LR"
FT   gene            42260..43075
FT                   /locus_tag="NGR_c00400"
FT   CDS_pept        42260..43075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00400"
FT                   /product="predicted 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00400"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23844"
FT                   /db_xref="GOA:C3MF07"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF07"
FT                   /protein_id="ACP23844.1"
FT                   /translation="MINWIRVALYAILLAIISLLLMPIQLFCLWLDLKPRRVLPRFWHR
FT                   IACRLLGLRVRVHGQLDRRRPLLISANHVSWKDIMVLSSVADVVFVAKSEVKDWPVFGL
FT                   LARLQASVFIERQEKRKTGDQVSEIGRRLADSEIVVLFPEGTTSDGNRLLEIKTSLFGA
FT                   AASAVPQSPTGVVHVQPVAISYTGIHGMPMGRYHRPIAAWPGDIGLLPHLVGVLREGAL
FT                   DVEVDFGEAVDYHHRSNRKEVSRLVEQRIRSMLSDRLRGRAAARQKSAA"
FT   gene            43154..44554
FT                   /gene="miaB"
FT                   /locus_tag="NGR_c00410"
FT   CDS_pept        43154..44554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaB"
FT                   /locus_tag="NGR_c00410"
FT                   /product="putative tRNA-i(6)A37 modification enzyme MiaB"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00410"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23845"
FT                   /db_xref="GOA:C3MF08"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF08"
FT                   /protein_id="ACP23845.1"
FT                   /translation="MTQETALLPKSPRAGDEHVPARKVFVKTYGCQMNVYDSDRMSDAL
FT                   SRDGYVATDVLEDADFVLLNTCHIREKAAEKVYSELGRLRELKKAKASEGREMVIGVAG
FT                   CVAQAEGNEILRRAPAVDLVIGPQTYHRLPEALKRARSGERVVETDYAIEDKFEHLPAP
FT                   DKAKTRSRGVTAFLTVQEGCDKFCTFCVVPYTRGAEVSRPVAQILAEAEKLVDGGVREI
FT                   TLLGQNVNAWHGAGPNGRDWGLGDLLRRLGEIDGLARLRYTTSHPRDMDESLIEAHRSM
FT                   AKLMPYLHLPVQSGSDRILKAMNRRHTAAEYLALVERIRAVQPDLALSGDFIVGFPGET
FT                   EADFEETMRLVEVVGYAQAFSFKYSTRPGTPGADLKDQVPEDVKAKRLERLQSLLVNQQ
FT                   RDFAAACVGREIDLLLEKPGRMPGQLVGRSPWLQPVNVDAKRSQIGDIIKVRITKAGSN
FT                   SLFAEMIE"
FT   gene            44670..45725
FT                   /gene="phoH"
FT                   /locus_tag="NGR_c00420"
FT   CDS_pept        44670..45725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoH"
FT                   /locus_tag="NGR_c00420"
FT                   /product="phosphate starvation inducible family protein
FT                   PhoH"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00420"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23846"
FT                   /db_xref="GOA:C3MF09"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF09"
FT                   /protein_id="ACP23846.1"
FT                   /translation="MNGHEMISSSSRHSKTTATDANHFVLTFENNRFASELFGQFDQNL
FT                   KLLEERLRVDARPRGNSVAISGDVVATNQARRALDYLYGRLQSGASIDTSDVEGAIRMA
FT                   VAADDQLQLPTMERKAKLTMAQISTRKKTIAARTPMQDAYIRAMERSELVFGVGPAGTG
FT                   KTYLAVAHAAQLLERGAVDRIILSRPAVEAGERLGFLPGDMKEKVDPYLRPLYDALYDM
FT                   MPGDKVERAISAGVIEIAPLAFMRGRTLANAAVILDEAQNTTSMQMKMFLTRLGENGRM
FT                   IVTGDPSQVDLPRGVKSGLVEALQILKGVEGVSVIRFKDADVVRHPMVARIVRAYESHT
FT                   AVHDESEQSDR"
FT   gene            45743..46264
FT                   /locus_tag="NGR_c00430"
FT   CDS_pept        45743..46264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00430"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23847"
FT                   /db_xref="GOA:C3MF10"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MF10"
FT                   /protein_id="ACP23847.1"
FT                   /translation="MTALDIQISVEEGDWPSEDELQGLSTRILDVTVAFLIAEEKQPFP
FT                   DDPPELSLVFTDDQSIREINAEWRNQDKPTNVLSFPAFPVTPGNMPGPMLGDIIVAYET
FT                   LEREAAEMEKPFEEHLTHLLVHGFLHLFGYDHIEDDEAERMEGLETRILARLGLSDPYG
FT                   DQPRIDSLEQ"
FT   gene            46261..47421
FT                   /locus_tag="NGR_c00440"
FT   CDS_pept        46261..47421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00440"
FT                   /product="putative hemolysin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00440"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23848"
FT                   /db_xref="GOA:C3MF11"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF11"
FT                   /protein_id="ACP23848.1"
FT                   /translation="MSDFKTQPATVASEEADASGDADAGSSSTTARPEGSKPISSFWSR
FT                   AARLWRGAGASSLREDLADALMTDADSNTAFSPEERAMLNNILRFREIRVEDVMVPRAD
FT                   IEAVDQSITLGELMVLFEESGRSRMPVYSEGLDDPRGMVHIRDLLAYVTRQARNRRRNG
FT                   KAPHAVGADRAEKSPRQPRPGFDLSRVDLNKTVEEVSIIRQVLFVPPSMLASDLMQRMQ
FT                   AARIQMALVIDEYGGTDGLVSLEDIVEMVVGDIEDEHDDDEVMFARTSDDVFVADARVE
FT                   LEEIAEAIGPDFDVREQLEDVDTLGGLVFASLGRIPVRGEVVQAIPGFEFQILDADPRR
FT                   VKRVRIMRKRPPARRRVVKPEKETLPDALPANGGAQANASPPTTAE"
FT   gene            complement(47425..48000)
FT                   /locus_tag="NGR_c00450"
FT   CDS_pept        complement(47425..48000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00450"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23849"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF12"
FT                   /protein_id="ACP23849.1"
FT                   /translation="MFDSREKIALFIDGANLYATSKSLGFDIDYRKLLSAFQKRAYLVR
FT                   AYYYTALIEDLEFSSIRPLIDWLDYNGYTVVTKPAKEFTDALGRRKIKGSMDVELAIDA
FT                   LEQRQVVDHYVLFSGDGNFTTLVAALQRNGRKVTVVSTLSTQPPMIADELRRQADHFID
FT                   LIALRSEIDRHPQAAPQTVKPADESVNS"
FT   gene            48395..49990
FT                   /locus_tag="NGR_c00460"
FT   CDS_pept        48395..49990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00460"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00460"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23850"
FT                   /db_xref="GOA:C3MF13"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MF13"
FT                   /protein_id="ACP23850.1"
FT                   /translation="MERLAGKIILLSGASRAFVGFLAGLLAMFAQPPFGIFAAAFISFP
FT                   MLVWLIDGVATHPDEGVVRRLLPAASIGWSFGFGYFLGGLWWLGNAFLVEADLFAWAMP
FT                   LAVVGLPAVLALFYALAVLVARCLWSDGVGRIAALAVGFGVAEWLRSFLFTGFPWNAIG
FT                   YAAMPMPLMMQSASVLNVATINMLAVFVFAAPALIGTGKGARVGLAVAAALFAAHIGYG
FT                   YYRLSLPPPQPLTPERTVRLVQPVIDQAKKMDDRERAVIFEEHLALTAAPPQAGGKRPD
FT                   IVVWPETSIPFILTDNPDALARIADVLQDGQILVAGAVRAEDAGTGLPPRYYNSIYVID
FT                   DRGQIVGASDKVHLVPFGEYLPFEDVLNSWGLSSIAANMPGGFSAASNRSVLTLPGGRT
FT                   FYPLICYEAIFADEVDGSARLSDALLNVTNDAWFGDTPGPRQHFHQAQLRTIETGLPMI
FT                   RAANTGISAIVDARGVLVVGLGYNYKGVTDAILPGKMPTMTDSMLRGRIFWFTGVFLLL
FT                   VAAISRRGLNFRTN"
FT   gene            50137..50547
FT                   /locus_tag="NGR_c00470"
FT   CDS_pept        50137..50547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00470"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00470"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23851"
FT                   /db_xref="GOA:C3MF14"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF14"
FT                   /protein_id="ACP23851.1"
FT                   /translation="MVENKKKPNPIDIHVGSRIRLRRTMLGMSQEKLGESLGITFQQIQ
FT                   KYEKGTNRVGASRLQNISSILNVPVSFFFEDAPGEAGSGMAEAPSSNYVVDFLSSSEGL
FT                   QLNRAFVKISDPKVRRKLVDLVKALAAEAESE"
FT   gene            50771..52039
FT                   /gene="metK"
FT                   /locus_tag="NGR_c00480"
FT   CDS_pept        50771..52039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="NGR_c00480"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00480"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23852"
FT                   /db_xref="GOA:C3MF15"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF15"
FT                   /protein_id="ACP23852.1"
FT                   /translation="MRANYLFTSESVAEGHPDKVCDRISDEIVDLVYREAAKSGVDPWT
FT                   VRIACETLATTNRVVIAGEVRLPPSLLKKDKNGSDVINPAKFKAAARKAIRDIGYEQDG
FT                   FHWKTAKIDVLLHFQSAHIAQGVDNAADKQGEEGAGDQGIMFGYACRETAELMPAPIYY
FT                   SHRILNLLAAARKKGEGDVARLGPDAKSQVTVRYVDGKPTEVVSIVLSTQHLDDSWDSA
FT                   KVRKVVEPYIREALDDLKIADDCTWYINPTGKFVIGGPDGDAGLTGRKIIVDTYGGAAP
FT                   HGGGAFSGKDTTKVDRSAAYAARYLAKNVVAANLAERCTIQLSYAIGVAQPLSIYVDLH
FT                   GTGKVSEDQVEKAIRKTMDLSPTGIRRHLDLNRPIYAKTSAYGHFGRKAGRDGSFSWEK
FT                   LDLVKPLKEAISLDATAINSRAA"
FT   gene            52247..52945
FT                   /gene="trmB"
FT                   /locus_tag="NGR_c00490"
FT   CDS_pept        52247..52945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="NGR_c00490"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00490"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23853"
FT                   /db_xref="GOA:C3MF16"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF16"
FT                   /protein_id="ACP23853.1"
FT                   /translation="MTEPRRARATEAFFGRRKGKQLRERQAAQLENLLPVLRLDLKEPA
FT                   PTDLSALFPTAVNRVRLEIGFGGGEHLIHRAAEDPSTGFIGVEPFINSMAKLLGQIEAR
FT                   EIDNVRLYDDDATQVLDWLPPASVDQVDLLYPDPWPKRKHWKRRFVSKVNLDRFARVLK
FT                   PGGLFCFASDIDSYVNWTLIHCRDHAAFEWTAERSADWLTPFSGWPSTRYEAKARREGR
FT                   SSAYLTFRRA"
FT   gene            complement(53075..53332)
FT                   /locus_tag="NGR_c00500"
FT   CDS_pept        complement(53075..53332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00500"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23854"
FT                   /db_xref="InterPro:IPR009531"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF17"
FT                   /protein_id="ACP23854.1"
FT                   /translation="MGLKTITSSLSKNDLAHLGAGEVGYIRKMRSEEVSRCFPEAPEMG
FT                   PGIDLWALFAADGTPILLTDNRSSTFFKAAEDDLRTVSLH"
FT   gene            complement(53382..53813)
FT                   /gene="hspH"
FT                   /locus_tag="NGR_c00510"
FT   CDS_pept        complement(53382..53813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hspH"
FT                   /locus_tag="NGR_c00510"
FT                   /product="small heat shock protein Hsp20"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00510"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23855"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF18"
FT                   /protein_id="ACP23855.1"
FT                   /translation="MSRITPFTSPLLVGFDSMEKTLERIAKANDGYPPYNIERIRGDSA
FT                   AGTPERLRITLAVAGFSDEDLEVTTEENQLVIRGRQVETGERDYLHRGIAARQFQRTFV
FT                   LADGMRVLGAELRNGLLSVDLVRPEPVRMVKKINISVPE"
FT   gene            54068..55012
FT                   /locus_tag="NGR_c00520"
FT   CDS_pept        54068..55012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00520"
FT                   /product="inosine/uridine-preferring nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00520"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23856"
FT                   /db_xref="GOA:C3MF19"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF19"
FT                   /protein_id="ACP23856.1"
FT                   /translation="MTNARKIIIDTDPGQDDAAAIMLALGSPEEIDVLGVTTVAGNVPL
FT                   TLTTRNARIVCELCNRTDVKVFAGAERPVARPLVTAEHVHGKTGLDGPALTEPTMPLEE
FT                   QHAVDFIIETLLAEAPGTVTLCTLGPLTNIALALTKAPEIAPRVRELVMMGGGFFEGGN
FT                   ITPAAEFNVYVDPEAAEIVFRSGIPIVMMPLDVTHRVLTHRARVEKIRAIGSPAAVALA
FT                   EMLEFFERFDIEKYGTDGGPLHDPTVIAYLLRPELFTGRDCNVEIETTSALTTGMTVVD
FT                   WWQVTGRTHNAKVMRHIDDEGFFELLTDRLARL"
FT   gene            complement(55146..57521)
FT                   /locus_tag="NGR_c00530"
FT   CDS_pept        complement(55146..57521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00530"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00530"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23857"
FT                   /db_xref="GOA:C3MF20"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF20"
FT                   /protein_id="ACP23857.1"
FT                   /translation="MREDFMFNFHAKSLATKLIAVTGGTIALVLLASNFVLISQTQDRV
FT                   ETLVFDGAKTEARAIAADIAGSVGELAAAARTMSGVLGRGHAGKSTDRAGAINLLKANL
FT                   DQHDFAFGSWFAEEPKAFDGRDVVNNTELGGNAEGAFTPYWSKDRNGKAKLSTFRADYA
FT                   AEWYSLAAKSGKGAITQPYLAEGTDVPTTMTSIAYPVMSDGKMIGVSGADISLASLADR
FT                   LATLKPFGSGRVYLLSQGGKWLAAPIPDLLMKDYEGEGADVIKNALSSDASGMIKNLTY
FT                   DGNEPFDRVVYPFKLPDVNASWVILVDVPRTAINAPVNDQTYMMIIGGIVVLGAVLAGL
FT                   YLAVRRFVQKPLAGLVHDVETLSNGDYARPISGQDRLDETGSVAKALEGFRHQLADTKR
FT                   LEGEARHEREQAERERSRSESERAETGALQRDIVARLGKGLSHLASGDLAYRIADEFPG
FT                   EYAQLKRDFNATMESLEETIRTVNHSVVNIGSGTGEISSAANDLSHRTEQQAASLEETA
FT                   AALDELTSQVDASAENAKVAAKSVELASSDAAQSGEVVQKAIAAMQGIEQSSNEVSRII
FT                   GVIDEIAFQTNLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSANAAKEIKTLINTS
FT                   AGQVREGVDLVGKTGGALKKIAEQVVQINGLIRQISGSASEQAVGLKEINAAVNQMDQV
FT                   TQQNAAMVEETTAASMTLNEEARTLSGLVARFSVAKREPAQSSADMLRSAASRMRTAEA
FT                   PRPAPEQPAARGYSTPTQRVLAQTAGGNALARDNWEEF"
FT   gene            complement(57897..58796)
FT                   /locus_tag="NGR_c00540"
FT   CDS_pept        complement(57897..58796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00540"
FT                   /product="ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00540"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23858"
FT                   /db_xref="GOA:C3MF21"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF21"
FT                   /protein_id="ACP23858.1"
FT                   /translation="MITVFGSINMDLIATTARLPKPGETVAGTGFSTAAGGKGANQALA
FT                   ARRAGASVRMAGAVGSDGFAAGALALLKEAGTDLGFTKTVNEPTGTAHILVGGDGENVI
FT                   VVVASANATVSEGDAATAVEQMSAGDTLMLQLEIPAASVEKALVEAKRRGIRSVINIAP
FT                   LTPEAARLGRMADIVIANETEFELLAGKSGIAGAEREAAMKRLHDETGQTVIVTLGAEG
FT                   VAAAHGGEIHRAKGLTIEPVDTVGAGDTFCGYLAASLDAGLSFPDALRRAAVAGSLACL
FT                   KAGAQPSIPLASEVAARL"
FT   gene            complement(58848..60056)
FT                   /locus_tag="NGR_c00550"
FT   CDS_pept        complement(58848..60056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00550"
FT                   /product="putative DNA recombination protein RmuC"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00550"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23859"
FT                   /db_xref="GOA:C3MF22"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF22"
FT                   /protein_id="ACP23859.1"
FT                   /translation="MEPIAFSFDQPLFLIGSFPVTAGHLVILAAFLFVLAAIAAARRAR
FT                   MLRADDRDQQLSALLAAQTEMQGRIAAMADVFGARQAELNQSLSQRIDGMTHRIGASIS
FT                   EQTKATHENLRRLQERLAVIDSAQNNIQSLAKDMAGLQSILSNKQTRGAFGQSRMEAIV
FT                   ADGLPIGAFTFQSTLSNGARPDCIIRMPNGQPPLVIDAKFPLEAWNAMRDADSAERRHQ
FT                   ASQAFRRDMEVHIRDIASKYLLAGETQDTAFLFVPSESIFAEIHEHFEAIVQKAHRQRV
FT                   VIVSPSLLLLSIQVIQAILKDARMREQAHLIQGEVVRLMEDLTRLDERVRKLQGHFAMT
FT                   QKDVEDILISSDKLTRRGAKIEALELEAITSANHADKPIGDKADRTVDNRVGQLKLRVV
FT                   DED"
FT   gene            60245..60799
FT                   /locus_tag="NGR_c00560"
FT   CDS_pept        60245..60799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00560"
FT                   /product="putative NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00560"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23860"
FT                   /db_xref="GOA:C3MF23"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF23"
FT                   /protein_id="ACP23860.1"
FT                   /translation="MKVLAISGSTRRNSTNTAMLEAIRQVAAPRFDIRVFHRIGALPVF
FT                   SPDLEGEATPRSVRDFMEAIEASDGLILSSPEYVRTLPGGLKNAIDWLVSAEVIVSKPV
FT                   VLAHASHRGDDMLATLRTVMSTVTSNFNSEIFLRFPLMKETPEAIRQIVGTPENRSRVD
FT                   IFLKEFSEFCQSVRVDAVGQW"
FT   gene            60873..61397
FT                   /locus_tag="NGR_c00570"
FT   CDS_pept        60873..61397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00570"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00570"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23861"
FT                   /db_xref="GOA:C3MF24"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF24"
FT                   /protein_id="ACP23861.1"
FT                   /translation="MTIKPLIILPDPILRQVSTPVETIDADIRRLADDMLETMYDAPGI
FT                   GLAAIQIGVPRRLLVLDVSKEGEEKTPLVFINPKIVKSSEERSVYEEGCLSIPDYYAEV
FT                   ERPAAIAVEYLDRDGKQQSVEADGLLATCLQHEIDHLNGVLFIDYISKLKRDMVIRKFT
FT                   KAAKTRGAKAI"
FT   gene            61581..62516
FT                   /locus_tag="NGR_c00580"
FT   CDS_pept        61581..62516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00580"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00580"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23862"
FT                   /db_xref="GOA:C3MF25"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MF25"
FT                   /protein_id="ACP23862.1"
FT                   /translation="MPLRIIFMGTPEFSVPTLAALVEAGHEIAAVYTQPPRPGGRRGLD
FT                   LQKSPVHQAAELLGVPVLTPVNFKDAADRQAFRDFNADVAVVVAYGLLLPEEILSGTRY
FT                   GCYNGHASLLPRWRGAAPIQRAIMAGDRETGMMVMKMDKGLDTGPVALTKTVPIGETMT
FT                   AGELHDKLMHAGAALMKEAMVKLELGELPLTPQPQEGVLYAAKISKDETRIDFTKPAAD
FT                   VHNHIRGLAPFPGAWFELETAGRTERIKVLGSEPAAGAGAPGTILDDALTIACGDGAVR
FT                   PTRLQRAGGKPLATPDFLRGSPIAAGTRIC"
FT   gene            62516..63259
FT                   /gene="truA"
FT                   /locus_tag="NGR_c00590"
FT   CDS_pept        62516..63259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="NGR_c00590"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00590"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23863"
FT                   /db_xref="GOA:C3MF26"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MF26"
FT                   /protein_id="ACP23863.1"
FT                   /translation="MPRYRLTVEYDGSDYVGWQRQENGPSVQGAIEKAVLSLTGETVSI
FT                   RGAGRTDSGVHAMGQVAHLDLTREWKTHTLRNALNAHLALAAERVSILDAAEVPPEFDA
FT                   RFSAIRRHYLYRIISRRSPLALEARRAWWVPKTLDHEAMHEAAQHLVGHHDFTTFRSAH
FT                   CQANSPLRTIDRLDVTRSGELIEIRATAQSFLHNQIRSFAGSLKLVGEGKWTPDDLKTA
FT                   LEARDRKACGPVAPPEGLFFMQVDY"
FT   gene            complement(63273..63869)
FT                   /locus_tag="NGR_c00600"
FT   CDS_pept        complement(63273..63869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00600"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00600"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23864"
FT                   /db_xref="GOA:C3MF27"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF27"
FT                   /protein_id="ACP23864.1"
FT                   /translation="MPLLDEVLAYIKGLWLLIQGNRDGYNWLDISEGGLWRSFAAILWS
FT                   LPAMAVSWASWRLYYLSAMPSGTTVGIGFFLKLLVVDLVSWLLPIVLVAALSRPLGFGP
FT                   LVVPVIVTTNWLSVPLSYAMAIPAALLLLARGGHQLTALLSLIVLVAGVVLLFRLLRTI
FT                   TGNQNLLASALTALYLLPSMMLAQYLQHFFGLIPG"
FT   gene            complement(63856..65049)
FT                   /gene="dapE"
FT                   /locus_tag="NGR_c00610"
FT   CDS_pept        complement(63856..65049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="NGR_c00610"
FT                   /product="succinyl-diaminopimelate desuccinylase"
FT                   /EC_number="3.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00610"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23865"
FT                   /db_xref="GOA:C3MF28"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF28"
FT                   /protein_id="ACP23865.1"
FT                   /translation="MFPTDPISNLAALIRCPSVTPAEGGALTALEAMLAPLGFSVDRVV
FT                   AKEAGTPDIENLYARLGAEGPHLMFAGHTDVVPVGDEAAWSHPPFSAAIARGEMYGRGA
FT                   VDMKGGIACFVAAVARHIEKHGRPKGSISFLITGDEEGPAINGTVKLLEWAAQKGERWD
FT                   ACLVGEPTNPESLGDMIKIGRRGSLSGRITVHGVQGHAAYPHLADNPVRGILQLTQALM
FT                   DSAFDAGTDTFQPSNLEVTTIDVGNAAVNVIPARASAAFNIRFNDHWTAESLKAEIVAR
FT                   LDRAAKDETLRPGRQPVKYDIVWNERPSHVFLTRNNALIDSLSGAVEAVTGRQPKLSTT
FT                   GGTSDARFIKDYCPVVEFGLVGQTMHMVDERVAIADLETLTGIYEAFVARWFGHAAA"
FT   gene            complement(65205..68390)
FT                   /locus_tag="NGR_c00620"
FT   CDS_pept        complement(65205..68390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00620"
FT                   /product="AcrB/AcrD/AcrF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00620"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23866"
FT                   /db_xref="GOA:C3MF29"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF29"
FT                   /protein_id="ACP23866.1"
FT                   /translation="MNFSRFFVDRPVFAGVLSVLIFVAGLIGMTGLPISEYPEVVPPQI
FT                   VVRAQYPGANPSVIAETVATPLEEQINGVEGMLYMQSQATADGLMTLTVTFELGTDPDQ
FT                   AQQLVQNRVAQAEPRLPEEVRRLGVTTVKSSPDLTLVVHLISPNGQYDINYLRNYGVLN
FT                   VKDRLARVEGVGQVQIFGGGDYSMRVWIDPEKAAERGLAASDIANAIRGQNVQAAAGVI
FT                   GASPSVAGLDLQLSVNAQGRLRTPEDFAEIVVKSGENGEITRLGDVARVEMGAADYSLR
FT                   SLLDNKAAVGMGVFQAPGSNAIQISENIHKAMAELKQTMPEGVDYEIVYDTTQFVRASI
FT                   ESVVHTLLEAIALVVLVVIVFLQTWRASIIPLVAVPVSIVGTFAVMYVFGFSINALSLF
FT                   GLVLAIGIVVDDAIVVVENVERNIAQGLSPVQATYRAMQEVSGPIIAIALVLVAVFVPL
FT                   AFITGLTGQFYRQFALTIAISTVISAFNSLTLSPALAALLLKDHHAPKDSLTRIMDALF
FT                   SWFFRGFNRFFGASSEAYSRGVGGILTRKSLIMGLYVILLGVTFALFRSVPGGFVPAQD
FT                   KQYLIGFAQLPDAATLDRSEDVIRRMSDIALKHPGVEHAIAFPGLSINGFTNSSNSGIV
FT                   FVSLKPFEERTTPELSGGAIAMQLNQEFGAIQDAFIAMFPPPPVQGLGTTGGFKLQIED
FT                   KNGLGYRALDDAAKAFLAQAAQTPELAGLYSSYQINVPQLYADLDRVKARQLGVAVTDV
FT                   FETLQIYLGSLYVNDFNAFGRTYSVRIQADANYRSHADDIGKLKVRSQSGEMIPLSALL
FT                   TVEQTVGAERAIRYNGFLAADINGGPAPGFSSGQAQEAIERIAAETLPPGISYEWTDLT
FT                   YQQILAGNSGVLIFPLALLLVYLVLAAQYESLLLPISIILIVPMGIMAALTGVWLTGGD
FT                   NNVFTQIGLIVLVGLSAKNAILIVEFARELELSGSSAVSAAIEASRLRLRPILMTSMAF
FT                   IMGVVPLVTSTGAGAEMRSAMGVAVFAGMIGVTAFGIFMTPVFYVLIRKLSGERPLKHA
FT                   GGHIEAPHLAPGE"
FT   gene            complement(68515..69720)
FT                   /gene="mexE"
FT                   /locus_tag="NGR_c00630"
FT   CDS_pept        complement(68515..69720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mexE"
FT                   /locus_tag="NGR_c00630"
FT                   /product="HlyD family secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00630"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23867"
FT                   /db_xref="GOA:C3MF30"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF30"
FT                   /protein_id="ACP23867.1"
FT                   /translation="MTSSVTRRALWGAGLSILLSVAGGGAVLLGLPAHLKADAATEASP
FT                   AAPPAVPVSVAKAETRRITTWESFSGRLEAIERVEVRPRVGGAILSAHFREGALVEKGD
FT                   LLVTIDPEPYAAAVERAEAEVAAAEARVALAKTELDRARKLVSTSAIPQSGVDQRSSAY
FT                   DEAQANVRSAKAALRSARLDLGYTEVRAPIAGRAGRLEVTAGNLVAAGSASPVLTTLVS
FT                   VDPIYASFNVNEEVVAAALAKLSASAGADSIERIPVEIGTAADEGTPISGHIQLINNEV
FT                   DAATGTIRVRAALENPDGRLIPGQFVRIRIGDPAPAEKLVISDRAIGSDQDKKFVLVVG
FT                   SDNKVEYRQVTLGPTSDGMRIVESGLKPGESIVVNGLQRVRPGVVVAPQPAEQATASIA
FT                   KP"
FT   gene            complement(69761..70576)
FT                   /locus_tag="NGR_c00640"
FT   CDS_pept        complement(69761..70576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00640"
FT                   /product="putative lipase / esterase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00640"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23868"
FT                   /db_xref="GOA:C3MF31"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF31"
FT                   /protein_id="ACP23868.1"
FT                   /translation="MDTHFTEETMQTGQGSCSARVYKGASLLVPPPVVLHLHGGSFTGD
FT                   SVAAGEKVANALAAAGAVVISPEYPSACLNPFPAALDAAYAMLASMRSRCPQFAHKKSL
FT                   LFVAGEEAGGNLAAGLALMARDQFLTDLKGQILLSPLLDPCLATPSFRKFCPQGSVQSI
FT                   AEGWQQYLGEGRGLTHPYAAPGHCTRLGGLVPALVITSEECPMRDEAKAYAERLREAGV
FT                   PVEMHVLPGRAAWIPANAAAQESWPAQEETISGIFSRFFQKAGAKATQK"
FT   gene            70713..71624
FT                   /locus_tag="NGR_c00650"
FT   CDS_pept        70713..71624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00650"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00650"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23869"
FT                   /db_xref="GOA:C3MF32"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF32"
FT                   /protein_id="ACP23869.1"
FT                   /translation="MDQLTAMRVFLRVVETGNFTRASVSLNMPKATVTNLIQGLEAHLR
FT                   TKLLNRTTRRVLVTPDGALYYERAARLLSDIDELDGSLSSAQSLPKGRLRVETASAFAN
FT                   LIIIPALPEFQAKYPDIQIDLGVSDRTIDYLAENVDCAIRGGTLTDQSLIARRITEMKF
FT                   ITCASRDFLERHPMPQHPSDLEKNTHAVGYFLPKSGQQMRFQFRRGNEEIEIDSRYAVA
FT                   ANEATTYVAAARAGMGVIQAPFFMVRDDLRAGTMVPVLPDWQVDPMPVYLVYPPNRHLS
FT                   SRLRVFADWVVKVIAQSQLDGA"
FT   gene            complement(71654..73555)
FT                   /locus_tag="NGR_c00660"
FT   CDS_pept        complement(71654..73555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00660"
FT                   /product="DEAD/DEAH box protein, ATP-dependent RNA
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00660"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23870"
FT                   /db_xref="GOA:C3MF33"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF33"
FT                   /protein_id="ACP23870.1"
FT                   /translation="MTEFEGIAPAIAEALAKRGYNTLTPVQQAMLDPALEGADALVSAQ
FT                   TGSGKTVAFGLALGPTLLGPARQFDSPGAPLALVIAPTRELALQVKRELEWLYEITGAT
FT                   IASCVGGMDIRSERRALERGAHIVVGTPGRLCDHIRRDSLDISALRAIVLDEADEMLDL
FT                   GFREDLEFILEASPTERRTLMFSATVPRSIATLAKNYQRDAVRIGVASEQKQHGDIEYR
FT                   SLLVAPSDRENAIINVLRYYDARNAIVFCSTRAAVNHLTARFNNRGFSVVALSGELSQN
FT                   ERNHALQAMRDGRARVCIATDVAARGIDLPGLELVIHADLPTNPDTLLHRSGRTGRAGQ
FT                   KGVSALIVPVNQRRKAERLLDGARITATWAKPPSAEDVTGRDDERLIADAAFDEPLRDD
FT                   EQTIVQALIDRHGAEKLAAAFVRQFRSSRSAPEELSDVPLFDDRKKARRDAPAFTGDSA
FT                   AAPRADFTDGQWFSLSVGRKQNAEPRWLIPMLCRHGKLSKRDIGAIRMQPEETYVELTA
FT                   DGAERFLTAIGPNRTLEKGIRVKTLPGAPDGSRPRDDKPEFAKKRPRPAEAQPERGQKD
FT                   FQPKRKFEKKPPVSQDTNPEKRDEKPWSKKKGKPDARKAAGDFKPKAKRNNAKNRQA"
FT   gene            complement(73709..74065)
FT                   /locus_tag="NGR_c00670"
FT   CDS_pept        complement(73709..74065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00670"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23871"
FT                   /db_xref="GOA:C3MF34"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF34"
FT                   /protein_id="ACP23871.1"
FT                   /translation="MTWLFFSPSGRIGRLPFFLSWLLWLVLGGIILMQMLKYEDQDAAL
FT                   ALWTLAMIGSGVASTVSIAMLAIKRLHDIGYPGPLALCLFIPVLSPIVFIALCLWPGAP
FT                   GANEFGGHRNGPRR"
FT   gene            complement(74095..74952)
FT                   /gene="dapD"
FT                   /locus_tag="NGR_c00680"
FT   CDS_pept        complement(74095..74952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="NGR_c00680"
FT                   /product="2,3,4,5-tetrahydropyridine-2,6-dicarboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00680"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23872"
FT                   /db_xref="GOA:C3MF35"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MF35"
FT                   /protein_id="ACP23872.1"
FT                   /translation="MTNHDLASLSQTIETAFEDREAVSTSTRGAIRDAVEAALNLLDSG
FT                   KVRVAERGADGTWTVNQWLKKAVLLSFRLNPMELVKGGPGESVWWDKVASKFDGWSVNE
FT                   FEKAGFRAVPNCVVRRSAYIAPNAILMPSFVNLGAYVGEGTMVDTWATVGSCAQIGKNV
FT                   HLSGGVGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIV
FT                   DRATGEVTYGEVPPYSVVVAGSMPSGSTMANGQPAPNLYCAVIVKRVDEKTRSKTGINE
FT                   LLRD"
FT   gene            75258..76157
FT                   /locus_tag="NGR_c00690"
FT   CDS_pept        75258..76157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00690"
FT                   /product="conserved hypothetical protein, possible lysine
FT                   decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00690"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23873"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF36"
FT                   /protein_id="ACP23873.1"
FT                   /translation="MGRMKKRSLRGKGGVWDPLADSSQSRQRASTVPLTPQSASPTYRL
FT                   AYIDDDFLCREELRPVRLQLELLKTEMMLEERGINSTVVMFGGARIPEPGGEAWAAKNE
FT                   TQRKNLEAASVYYDEARKFARLCSEQSAKLGHKEYVIVTGGGPGVMEAGNRGAADVGAP
FT                   SIGLNIVLPHEQAPNSYVTPELSFNFHYFAIRKMHFLLRAKAVAVFPGGFGTLDELFET
FT                   MTLMQTGRLALVPLVLFGEKFWRSIINFEALAEFGTIAPNDIDLVHFVETAEEAWEIIA
FT                   RFYETVDPRSVPMASGRR"
FT   gene            complement(76235..77005)
FT                   /locus_tag="NGR_c00700"
FT   CDS_pept        complement(76235..77005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00700"
FT                   /product="putative pyrimidine 5-nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00700"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23874"
FT                   /db_xref="GOA:C3MF37"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF37"
FT                   /protein_id="ACP23874.1"
FT                   /translation="MSPRNKSVFLAGAPCHKAAMKKLDRLPTREEFAHVTDWVFDLDNT
FT                   LYPHHVNLFAQIDKNMTAYVAELLSLEPAEAKKLQKEYYRDHGTTLQGLMIHHGIDPND
FT                   FLERAHAIDYSVVPANPDLGDAIKALPGRKFIFTNGSVAHAEMTARALGILDHFDNIFD
FT                   IVAAGYLPKPAGDTYDKFMSLHRVDTQHAAMFEDLPRNLLVPKALGMKTILLVPRNLEY
FT                   EFAEAWETSSDADEQIDYVTEDLAGFLRRVVAEA"
FT   gene            77052..77966
FT                   /locus_tag="NGR_c00710"
FT   CDS_pept        77052..77966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00710"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00710"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23875"
FT                   /db_xref="GOA:C3MF38"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF38"
FT                   /protein_id="ACP23875.1"
FT                   /translation="METWVLITVAAAFLQNIRSSMQKHLKGAMGTTGATFVRFGFGLPF
FT                   ALLYLLMLWRVAGHPLPVPNATFFLWAAVGGMAQIAATFLLVHLFSFRNFAVGTAYSRT
FT                   EPAQAALFGLIFLGEKASQGTLVAIAISVVGVMLISVARTTLSTRSLLTSVFSPTAAIG
FT                   LFSGTFFGLSAVSYRSASLALAPSLPAPDFMMQASFTLGFVILLQTAVMLLWIVAREPD
FT                   ELKRIGSAWKPAFVVGFVGSSASFGWFMAMTLQQAAIVKVVAQVEMIFTFASSFFIFRE
FT                   WINRLELVGCLLIVLGVVMLLVL"
FT   gene            78122..78949
FT                   /locus_tag="NGR_c00720"
FT   CDS_pept        78122..78949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00720"
FT                   /product="putative carboxyvinyl-carboxyphosphonate
FT                   phosphorylmutase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00720"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23876"
FT                   /db_xref="GOA:C3MF39"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF39"
FT                   /protein_id="ACP23876.1"
FT                   /translation="MARGQDETCRAFHGGDAMNQEERARVFAALHRKGDPIVLYNIWDA
FT                   GSARCVAEAGARALATGSWSVAAAHGFGDGQKIPLQLLVEIAREIVAATDLPLSVDFEG
FT                   AYSEDPAQGAANVAQLIDAGAIGINFEDQVVGKGGVHPIGKQAARIRAIREMGERQSVP
FT                   LFINARTDLFLQESDAARHPGLMHDAIARAKAYAEAGASGFFAPGLADAELIGKLCAQS
FT                   ALPVNVMMKPGAPDLATLAAAGVGRVSYGPFPYRAMTAWLKGEAEKVYGSAGT"
FT   gene            complement(79080..80282)
FT                   /locus_tag="NGR_c00730"
FT   CDS_pept        complement(79080..80282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00730"
FT                   /product="integrase catalytic core domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00730"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23877"
FT                   /db_xref="GOA:C3MF40"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF40"
FT                   /protein_id="ACP23877.1"
FT                   /translation="MVWRETGIMEERLKFVAACLSGEETMAGLCALYGISRKTGYKWLR
FT                   RFQLRGPAGLEDLPRAPLNHGRATAAELVERIVAEKEAHPLWGPKKIVARLARQDPATA
FT                   WPSASTAGAILNRHGLVGRRRARWKGAGNGPWPEPAMPNAVWTGDHKGWFTTRDGWRCE
FT                   PLTVMDVKSRYLLALEATGSTGDEEAWPVFERLFDEHGLPDRIRTDNGPPFAAAGVTGL
FT                   TPLSLRFVRLGITLERIAPGKPQQNGKHERFHLTMLPLAKAPAADRAAQAEAFEAFRRE
FT                   YNEERPHETLGMDTPAEHYRASTRKMPVSPPEPDYPAEAAVRKVRHNGAVKWQGAEIYV
FT                   SATLVGEVVAIEETESGEWAMRFYAHRLGFIDEKRGRLVRKTVLQPRPAVGLADELREE
FT                   L"
FT   gene            complement(80464..81351)
FT                   /gene="argB"
FT                   /locus_tag="NGR_c00740"
FT   CDS_pept        complement(80464..81351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="NGR_c00740"
FT                   /product="N-acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00740"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23878"
FT                   /db_xref="GOA:C3MF41"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MF41"
FT                   /protein_id="ACP23878.1"
FT                   /translation="MSASESEIQARLLAQALPYMQRYENKTIVVKYGGHAMGNPELGRA
FT                   FASDIALLKQSGVNPIVVHGGGPQIGAMLNKMGIESKFEGGLRVTDEKTVEIVEMVLAG
FT                   SINKEIVALINQTGEWAIGLCGKDGNMVFAEKARKTIKDPDSNIERILDLGFVGEVVEV
FT                   DRTLLDLLARSEMIPVIAPVAPGRDGHTYNINADTFAGAIAGALNATRLLFLTDVPGVL
FT                   DKQGNLIKELSVAQAHALIADGTISGGMIPKVETCMEAIKAGVQGVVILNGKTAHSVLL
FT                   EIFTERGAGTLIVP"
FT   gene            81610..82149
FT                   /locus_tag="NGR_c00750"
FT   CDS_pept        81610..82149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00750"
FT                   /product="predicted RNA polymerase sigma-70 factor"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00750"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23879"
FT                   /db_xref="GOA:C3MF42"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF42"
FT                   /protein_id="ACP23879.1"
FT                   /translation="MADKEISTLLGRVALGDRDAFATLYRRTSPKLFGICLRILKDRGE
FT                   AEEALQDIYVKIWHRADRFLAGEAHPMSWLAAIARNQAIDRLRARKPVANAIDEAYDLA
FT                   DPALDPERSAVIRSEGRRIEACLEELEADRAEAVRRAYVEGLSYQELAEIFAVPLNTMR
FT                   TWLRRSLLKLRECMER"
FT   gene            82146..82865
FT                   /locus_tag="NGR_c00760"
FT   CDS_pept        82146..82865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00760"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23880"
FT                   /db_xref="GOA:C3MF43"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF43"
FT                   /protein_id="ACP23880.1"
FT                   /translation="MTTQKPESGDSRRDEVIAGEYVLGVLSAEDRRQVEARMATDRNFA
FT                   AMVVRWQSNLAHIDMAYEPVTPPPHVFAAIESRVFESPASPKKSAGLWNSLSFWRSLAI
FT                   ASLAAVAVLGISMLELFSAGQGGKPLVAELQGQGNGLGLALVAQFDIGTGRLRVTPVAA
FT                   RQAEEKSLELWLIKGSDPAISLGVLPQSGEGEIRVSPAVRSKITEGSTLAVSLEPLGGS
FT                   PTGAATGPVIALGTTRR"
FT   gene            83058..83615
FT                   /locus_tag="NGR_c00770"
FT   CDS_pept        83058..83615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00770"
FT                   /product="conserved hypothetical protein contains
FT                   beta-Ig-H3/fasciclin domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00770"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23881"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF44"
FT                   /protein_id="ACP23881.1"
FT                   /translation="MFRSVFHSAALASILAVGATVAHAENPMVGGAPMYAEKNIVENAV
FT                   NSKDHTTLVAAVKAAGLVETLQGKGPFTVFAPTDDAFGALPTGTVDMLLKPENKDKLAK
FT                   VLTCHVVAADAMSSAIAKMIADDGGAHDVKTVGGCILKARSDGGKIGLTDETGSTAWVT
FT                   IADVKQSNGVIHVINKVLLPKG"
FT   gene            83743..84261
FT                   /locus_tag="NGR_c00780"
FT   CDS_pept        83743..84261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00780"
FT                   /product="putative methionine sulphoxide reductase B"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00780"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23882"
FT                   /db_xref="GOA:C3MF45"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF45"
FT                   /protein_id="ACP23882.1"
FT                   /translation="MTQTGGFPMMSRRNFLTSGAALAALAAAGEITQPARASKSGETFE
FT                   ITRTDAEWRGLLSEERYRILRQEDTERPFSSALNSEKRNGLFHCAGCGLPVYSSEAKYD
FT                   SGTGWPSFWQSLPGAIGKRDDNSLFMTRTECHCRRCGGHFGHIFDDGPPPTGKRHCING
FT                   LALTFAPVL"
FT   gene            complement(84393..84932)
FT                   /locus_tag="NGR_c00790"
FT   CDS_pept        complement(84393..84932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00790"
FT                   /product="putative membrane associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00790"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23883"
FT                   /db_xref="InterPro:IPR009200"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF46"
FT                   /protein_id="ACP23883.1"
FT                   /translation="MSDLIVIGFDTPEEADRVLLKLHSLKKEYLIDLEDAVVVVRDTDG
FT                   KVHLKQSINLPTVGAASGLLSGSLWGGLVGLLFLNPLAGFAIGGAIGAGAGALSGSLAD
FT                   YGIDDDFIKSLGSTIPNNSSALFILVRKVQPEKVLAELSGLRGRVLKTSLSPEQEHKLQ
FT                   AALSDAQTPSPPAGTF"
FT   gene            complement(85072..85725)
FT                   /locus_tag="NGR_c00800"
FT   CDS_pept        complement(85072..85725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00800"
FT                   /product="predicted GTP-binding protein EngB-related"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00800"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23884"
FT                   /db_xref="GOA:C3MF47"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MF47"
FT                   /protein_id="ACP23884.1"
FT                   /translation="MAETTTKDDKPLFGRPWIFIRGVPSMKFLPPEGPAEIAFAGRSNV
FT                   GKSSLINALVGHKGLARTSNTPGRTQELNYFVPDGYSGEADDLPPMALVDMPGYGYAQA
FT                   PKEQVDAWTKLVFDYLRGRSTLKRVYVLIDARHGIKKNDEEVLALLDKAAVSYQIVLTK
FT                   TDKIKAAGVPRLIAETLDKIKKRPAAYPEVLSTSSEKGAGIEDLRITIEQAVAR"
FT   gene            complement(85782..86714)
FT                   /locus_tag="NGR_c00810"
FT   CDS_pept        complement(85782..86714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00810"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00810"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23885"
FT                   /db_xref="GOA:C3MF48"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF48"
FT                   /protein_id="ACP23885.1"
FT                   /translation="MTDPSATSASFGANEKFGTLLVFGSAFFWSFGGAIARFLHISDSW
FT                   TIVFWRCLFAGLFLLAFMLVRDGPRGTVSLVRGMGWPGVAVGLCFTTASTSFIIAISYT
FT                   TIANVVLLGAGVPLFAALMSWVLFRERVSRFTWGAIAAVIFGVAIMVSESLNGSVSPVG
FT                   DALALLIPVVFALATVITRRYPHVRMTPATCFGCFAASAIAASQSSDLSVTPGELALLF
FT                   AFGAFNLGLGMALFVTGARLVPSALAALLGTAETVLAPVWVAIIHGEVPSGRTIVGGVF
FT                   IFLALLAYLFNEFRGQRNGPRRPVRTPTP"
FT   gene            complement(86963..88741)
FT                   /locus_tag="NGR_c00820"
FT   CDS_pept        complement(86963..88741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00820"
FT                   /product="putative inner membrane protein translocase
FT                   component YidC"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00820"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23886"
FT                   /db_xref="GOA:C3MF49"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MF49"
FT                   /protein_id="ACP23886.1"
FT                   /translation="MMENNRNYFVAIALSVLILVAWQYFYVNPRMDKDRIAAEKAQQTQ
FT                   QVQPQQGGQQPAPGQALPGGAVPGESRDQAVAKSARVAIDTPALSGSINLTGARFDDLK
FT                   LKGYHETVDPKSPVITLFSPAETADGYFTEIGYIGNDASGSVPGPQTVWTLSGGEKLTP
FT                   ATPVTLTYTNDKGITFARTISIDENYMFQVVDSIKNDGSAPVSLSSYGRVTRFNKPTTP
FT                   SIYVLHEGFIGVAGGSLQEVGYSKIEENLPVEPGKTTGGWHGITDKYWAAAIVPPQETP
FT                   FDIRFSHFTDGRPRFQSDYKGDAVTVAPGQSAEVKNLVFAGAKEVQVVDTYTTAYAIPK
FT                   FEKLIDWGWFWFITQPMFKMMDFFFRLFGNFGVAILVTTIVVKLIFFPLANKQYASMAN
FT                   MKKVQPKMEELKKKFGDDRMGLQQAMMQLYKDEKINPLAGCWPILIQIPVFFALYKVIY
FT                   ITIEMRHAPFFGWIRDLSAPDPTTIVNLFGLLPFDGPAFLHLGIWPIIMGVTMFLQMRM
FT                   NPTPPDPTQAMLFTWMPLVFTFMLASFPAGLVIYWAWNNTLSITQQSIIMKRQGVKIEL
FT                   FDNLKGLFTKRPKPAE"
FT   gene            complement(88738..89124)
FT                   /gene="rnpA"
FT                   /locus_tag="NGR_c00830"
FT   CDS_pept        complement(88738..89124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnpA"
FT                   /locus_tag="NGR_c00830"
FT                   /product="ribonuclease P protein component"
FT                   /EC_number="3.1.26.5"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00830"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23887"
FT                   /db_xref="GOA:C3MF50"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF50"
FT                   /protein_id="ACP23887.1"
FT                   /translation="MTSEKDKSTVGRLKSRPQFLAVRAGEARKGPHFLLEVLDRKDPEG
FT                   EARVGFTVTKKHGNAVERNRMRRRLKEAVRLSAGFAMKPGHDYVIVARRDLLNAPFDAL
FT                   TRGLQDRIENKPKPKRPPAGSRKP"
FT   gene            complement(89157..89291)
FT                   /locus_tag="NGR_c00840"
FT   CDS_pept        complement(89157..89291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00840"
FT                   /product="50S ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00840"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23888"
FT                   /db_xref="GOA:C3MF51"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MF51"
FT                   /protein_id="ACP23888.1"
FT                   /translation="MKRTYQPSKLVRKRRHGFRARMSTKGGQKVLAARRARGRKRLSA"
FT   gene            89613..91610
FT                   /locus_tag="NGR_c00850"
FT   CDS_pept        89613..91610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00850"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00850"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23889"
FT                   /db_xref="GOA:C3MF52"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF52"
FT                   /protein_id="ACP23889.1"
FT                   /translation="MRIRGKIYLIVGIMSLLAVAITGMSLLIVSKYNDELGQFQNASER
FT                   SFKGERLNRLVTAVVMESRGVYAAPTIEKATPFAEGIIKNLGKIDALLKEWRPLVPADR
FT                   LPAFDAVAKRAEEFKAFRTETARLGREVSPQAANEQGNNEANRANRKAFQAEIDVVVDA
FT                   DRESLQAITDGIAAFERTVVLIVLGIAGLGMAAGIGTAFYIGTNHLSRPIVDLTGRMKL
FT                   LAGGDLSVDVPFAGRKDEIGDMAAAVEVFKQNGLAVRELNAQEAALREKSADLQSSIGI
FT                   VVAAAAAGDFAQRIGKDYDNDDLNRFAASVNELVGSVDSGIAETRRVIASLAAGDLTES
FT                   MDGSFQGAFAELQKNVNETFTTLQKTMREVRSATDSINGNASELRSAADDLSKRTEQQA
FT                   AALEETSAALDEITAAVRSSTERAHEATIMVTEAKENAAESASVVRNAIDAMGRIEQAS
FT                   SEIGQITNVIDEIAFQTNLLALNAGVEAARAGDAGKGFAVVAQEVRELAQRAASAAKDI
FT                   KGLISKSGSEVATGVKLVQATGAALGEIETRVLKINDHIHSIATAAREQSTGLGEVSTA
FT                   VNQMDQVTQRNAAMVEEANAATHKLSAEANGLATLITYFKVDREPARTITPARETARPV
FT                   ASPARRMMGTVARAFGGGSAAAARSDWEEF"
FT   gene            91805..92602
FT                   /locus_tag="NGR_c00860"
FT   CDS_pept        91805..92602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00860"
FT                   /product="hypothetical protein contains SNARE associated
FT                   Golgi protein region"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00860"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23890"
FT                   /db_xref="GOA:C3MF53"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF53"
FT                   /protein_id="ACP23890.1"
FT                   /translation="MSHGVSNGAEEKTALRARPGRDERVSGGGRSLWRAVPLALLIAGG
FT                   LAFYALGLQHHVSLSALVRHQEALSLHVDAFPVRSVLVFFFAYVAAVVFSIPAASVLTM
FT                   SAGFLFGPFLGGTITVLAATLGSSLLFLAARGVLSDLLRRRAGRFLERLAEGFRRNAFL
FT                   YLLILRLAPIFPFFIVNIAPAFFDVKLRTFVAATLIGIVPATFAYAWLGCGLDDVIERA
FT                   GESGHALALSDFATKEISLALLALALFAALPLAYRLLQSRRQG"
FT   gene            92621..94045
FT                   /locus_tag="NGR_c00870"
FT   CDS_pept        92621..94045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00870"
FT                   /product="predicted mercuric reductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00870"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23891"
FT                   /db_xref="GOA:C3MF54"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF54"
FT                   /protein_id="ACP23891.1"
FT                   /translation="MGEIRNPDICVIGGGAAGLSVAAGAAAFGVPVVLVERGRMGGDCL
FT                   NYGCVPSKALIAAARQAQAMRQAGAFGLVAAEPFIDGERLQARIRSVIEGIAAHDSVER
FT                   FSGLGVEVIQETARFLDDRTVAAGTYLIRARRFVIATGSSPAVPPIAGLAEVPYLTNES
FT                   LFEFTPLPRHLVVVGAGPFGLEMAQAHCRLGARVTVVERADALSKEDTELKAIVLDAIR
FT                   TEGTALHERTTIRSIERDGDGVRLHCVDKKGGFDIEGSDLLLATGRTGNHAALDLGAAG
FT                   IRHDAERIHVGADLRTSNRRVYAIGDAAGGLQFTHAANYHARLVLQQILFRLPGRETRK
FT                   IVPRVTFTDPEIAQVGATEEEARASFGTVEVVRSDLSGSDRARTDGLDRGMIKIVVGRG
FT                   GRILGAGIAGAAAGEMINLWAFAIANRLTLKNFRDYVAPYPTLSEIGKQAAISYYSPMV
FT                   RNRFVRSAIGILRRFG"
FT   gene            94067..95548
FT                   /locus_tag="NGR_c00880"
FT   CDS_pept        94067..95548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00880"
FT                   /product="two component sensor histidine kinase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00880"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23892"
FT                   /db_xref="GOA:C3MF55"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF55"
FT                   /protein_id="ACP23892.1"
FT                   /translation="MVEDARPANESAPPRAAVGFLRGLSGKLLLLTIAFVMLAEVLIFV
FT                   PSVANMRIRWLEDRLNTVAAAAVVVDGLQNIELPRAVQRETLMATGTKAIVIRRKDASR
FT                   MIATVDMPPQIDGEYDVANFTALGAIRDAFDTLLFGGTRIMRVYGPLGESEATIELVMK
FT                   DASLRKAMLVYSRNVFLLSIVISLITAALIFLAINRMLIVPIKRLTTSMQEFSDEPSSP
FT                   ERVLVPPDGGDELALAGQHLASMQRELQKTLKQQKSLAELGLAVSKINHDMRNILSSAQ
FT                   LISDRLADVDDPVVKRFAPTLLRTIDRAVGYTQEVLSYGRTAEAEPHRRFVALRPLVQD
FT                   VGELLAVDRQGGIEFDVQVRDDIMVDADSEQLFRVVHNICRNAVQALTNHQPDDGRPAM
FT                   ISVSAVRTGSVVTISIEDTGPGMPAKARENLFAAFRGSARSGGTGLGLAIARELVLAHG
FT                   GTIALVEKPTPGTLFRIELPDRPVRLDAFRAKGRS"
FT   gene            95701..95777
FT                   /gene="trnR1"
FT                   /locus_tag="NGR_c00890"
FT                   /note="tRNA-Arg1"
FT   tRNA            95701..95777
FT                   /gene="trnR1"
FT                   /locus_tag="NGR_c00890"
FT                   /product="tRNA-Arg"
FT                   /note="codon recognized: CGU"
FT   gene            complement(95864..96334)
FT                   /locus_tag="NGR_c00900"
FT   CDS_pept        complement(95864..96334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00900"
FT                   /product="YbaK/aminoacyl-tRNA synthetase associated region"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00900"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23893"
FT                   /db_xref="GOA:C3MF56"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF56"
FT                   /protein_id="ACP23893.1"
FT                   /translation="MTIARKLQHYIETEGIDYDTVPHHRTATTSQTAEAAHVPGNRLAK
FT                   SVVVHHEMGYVLAVVPATHRVELSTLQDVMNRRLGLASEEEVSTLFSDCEIGAVPPIGS
FT                   AYGVPVILDESLDKANDVYFEGGDHRTLVHMSGTSFRNLTRDAQVARFSHPG"
FT   gene            complement(96498..97679)
FT                   /locus_tag="NGR_c00910"
FT   CDS_pept        complement(96498..97679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00910"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23894"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF57"
FT                   /protein_id="ACP23894.1"
FT                   /translation="MTRIHMRRLAVARTGAVLLAFPVAAMAEDRLPILAEDCTAPCAGY
FT                   EVTAELQNDWVFAADPSLLKSDELEPTITVDLFLAPTDNLRFVASIITEQVVEPEAGEN
FT                   AVFQGIGTYLAELYTAVATGPATIRAGKFDTIFSLASEVAPGINATELVSDIDADERLG
FT                   AEVVLDFGGLGMEQVLAATAFTTDRSVLGNSLFTRRGRTRLSDGGAGNTDGLSSFSMTL
FT                   DGCRGSEPIDCYLEGDFGYRLGIRYQAAGAQSGEDTEDSPGDEVGYLAAATTSLELDEM
FT                   TLRLLGETAYLRHFDGGSDDALLLTGSAALELEPVTYVASYTQQLNLVAGEPDRREHLA
FT                   DFEAIYEPREGTSLEGWEFAAAYTVARDADETAHIFSVRAVFNFDGDAELGSR"
FT   gene            98110..99852
FT                   /locus_tag="NGR_c00920"
FT   CDS_pept        98110..99852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00920"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23895"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF58"
FT                   /protein_id="ACP23895.1"
FT                   /translation="MPNFAAATFNPGAPINNPYLPLIPGHVLSYMGDETDPDTGEVTTE
FT                   RNDVFTTSASFEVRGVATTVIRDTVYEDDVIIEDTFDWYAQDTAGNVWYFGEIVVNYEY
FT                   DDDGNFVGVNHDGQWSADDPGNQPGWAMKASPEFGPAYYLEFAPGIAEDESILAETGLS
FT                   VKTSFGQFEDVIKIIDSSALSTGVEFKYYAPGVGEITETAVAPDGTATSQVDLYRNGIV
FT                   GQVDADDSDDVTPALAKLKESKTVEDLAEIRDLEMADFAGIGTTKQVTVIGGSTDSADA
FT                   LGAYFIDEATGAISEGRILVADLSDAASGTSIAVDVPDGQSLCLFLVRGTDEIGVDLEQ
FT                   FADGGMQLKNLLTGAPANVNDPFAPTVMDDAGNILPIQPLSALGADDGGNLLNPAGSMQ
FT                   AIGLSSSAAGASGIEIIGFEDRLNTSPDYDGDFNDAILAVSDAPIPAETLQQLVREAGG
FT                   GKTASSGIAQSSNEPAGEVPDGEQAEEADDSGTGESLEDTLDEWLTGDTFVFADGAHRV
FT                   GRVADLELDRWDGFLVDGDWVDFSHLERLCNDHPDGIGAHFDGVPDGVLKAGAALSADG
FT                   FFIA"
FT   gene            99902..100561
FT                   /locus_tag="NGR_c00930"
FT   CDS_pept        99902..100561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00930"
FT                   /product="hypothetical protein associated with LuxR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00930"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23896"
FT                   /db_xref="GOA:C3MF59"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF59"
FT                   /protein_id="ACP23896.1"
FT                   /translation="MAAVLRVAGRRRQRRWAMDWTKGRGRQILIFGAVGTFALLLGLEV
FT                   VKEEEEWTVAELLTEAVSIALLVGCSACVALLSSRLREQEADNLDLRDKVARIRESNAQ
FT                   WRADLADHFQELGAAIQRQFGAWGCTQAEQEVGLLLLKGFSHKEIARIRGASEATIRQQ
FT                   ATSVYHKAELSGRAALSAYFLEELLLPPVPTAQTSARGDGVARPENAEVSGRIVPG"
FT   gene            complement(100592..101269)
FT                   /locus_tag="NGR_c00940"
FT   CDS_pept        complement(100592..101269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00940"
FT                   /product="hypothetical protein contains isoprenylcysteine
FT                   carboxyl methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00940"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23897"
FT                   /db_xref="GOA:C3MF60"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF60"
FT                   /protein_id="ACP23897.1"
FT                   /translation="MVVRLIVQTVIWFGIMGAVLFASAGTFDWPAAWIYLAIMLALSLI
FT                   TGLLLAWHDPALLRERLAAPIQKDQPKADKVLLSVLLLFLFGAFAFMALDAARFKWSAV
FT                   PSWAQAAGALLLVLSIGFNYRVMRENSFAAPVVKVQSERGQSVVTTGPYRYVRHPLYSG
FT                   SLLFVAGTSLLLGSWWGLLAALGLAALLAIRIGIEEKALRAGLAGYDAYAQRVRYRLVP
FT                   YVW"
FT   gene            complement(101582..102010)
FT                   /locus_tag="NGR_c00950"
FT   CDS_pept        complement(101582..102010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00950"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00950"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23898"
FT                   /db_xref="InterPro:IPR014937"
FT                   /db_xref="InterPro:IPR036287"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF61"
FT                   /protein_id="ACP23898.1"
FT                   /translation="MSEAFDLERFVKAQEGVYESALAELRAGAKRTHWMWFIFPQIQGL
FT                   GHSSMAQYYALADLDEARAFLKHPLLGRRLRECTEAVNAVRGRSALSILGRPDDLKFRS
FT                   SMTLFEAADPTVGAFAKALDHYYHGARDPRTMEILGGA"
FT   gene            complement(102054..103040)
FT                   /locus_tag="NGR_c00960"
FT   CDS_pept        complement(102054..103040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00960"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00960"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23899"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF62"
FT                   /protein_id="ACP23899.1"
FT                   /translation="MKTRVLGRTGATISEIGFGAWQIGGSWGDVSEEDGKRALNAALDN
FT                   GVTFIDTADVYGDGRSEKIIAAVLKERGGEKPFVATKAGRRLNPHVADGYTGANVEAFI
FT                   DRSLKNLGVETLDLVQLHCPPTDVYYRPELFGALDKIAAKGKIRHYGVSVERVEEALKA
FT                   IEYPGVATIQIIYNIFRQRPHDLFFAEAKRKNVGIIVRVPLASGLLSGKIGKDTVFAAD
FT                   DHRNYNRHGEAFDVGETFAGVPFEAALEAVEELRRLVPADVPMAQFALRWIVAQEAVSV
FT                   VIPGARNAGQAQSNAAASALAPIGGATMEAIAALYERLIKVHVHQRW"
FT   gene            complement(103136..103915)
FT                   /locus_tag="NGR_c00970"
FT   CDS_pept        complement(103136..103915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00970"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23900"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF63"
FT                   /protein_id="ACP23900.1"
FT                   /translation="MPHTLHSLLTDATRPKFSGRALGRNGRQSPSHLWGGAMLRLGKQS
FT                   IEDDEAPPFRYQRCQTGKQRMFTLQRIETSAQEIRKSRFVAIAGSIDDEQAAKAFLAAH
FT                   SEPAANHNCWAWRIGQTYRFNDDGEPSGTAGKPILAAIDGQSLDRVVVVVTRWFGGVLL
FT                   GSGGLIRAYGGTAALCLRAAEKVERVETHRATVACDFADLALIKARLTARGIAIASESF
FT                   TDTGAMLVIDFRKDAAEATLTLVSDLSRGRAIVSLDT"
FT   gene            complement(103970..107677)
FT                   /gene="putA1"
FT                   /locus_tag="NGR_c00980"
FT   CDS_pept        complement(103970..107677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putA1"
FT                   /locus_tag="NGR_c00980"
FT                   /product="bifunctional PutA protein; includes: Proline
FT                   dehydrogenase; Delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase"
FT                   /EC_number="1.5.99.8"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00980"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23901"
FT                   /db_xref="GOA:C3MF64"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR041349"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF64"
FT                   /protein_id="ACP23901.1"
FT                   /translation="MSQTQLQKPTISTDAAPAPFADFAPPIRTQTTLRQAITAAYRRPE
FT                   TECLPPLVEAATLPRGTRDAAAGTARKLVEALRAKHKGSGVEGLVQEYSLSSQEGVALM
FT                   CLAEALLRIPDTATRDALIRDKISDGNWKSHLGGGRSLFVNAATWGLVVTGKLTSTVND
FT                   RSLAAALTRLISRCGEPVIRRGVDMAMRMMGEQFVTGETIDEALRRARALEQKGFRYSY
FT                   DMLGEAATTAADAERYYKDYEAAIHAIGKASAGRGIYEGPGISIKLSALHPRYARTQAA
FT                   RVMGELLPKVKALALLAKTYDIGFNIDAEEADRLELSLDLLEELCLDSDLADWNGMGFV
FT                   VQAYGKRCPFVLDFIIDLARRAGRRIMVRLVKGAYWDAEIKRAQLDGLEDFPVFTRKIH
FT                   TDVSYIACARKLLSATDAVFPQFATHNAQTLATIHHMAGKDFHVGKYEFQCLHGMGEPL
FT                   YEEVVGRENLGRPCRIYAPVGTHETLLAYLVRRLLENGANSSFVHRIADPGVSIDALIA
FT                   DPVEIVRAMPVVGAKHEKIALPAELFGAARPNSAGLDISNEATLAALTETLKASAAIGW
FT                   TAAPQLATGAASGETRPVVNPGDHRDRVGSVTETSEEDAKRAVRLAAEAAPSWAAVSPA
FT                   ERAACLDRAADLMQARMPTLLGLIVREAGKSLLNAIAEVREAIDFLRYYAEQTRRTLGQ
FT                   AHRPLGPVICISPWNFPLAIFTGQIAAALVAGNPVLAKPAEETPLIAAEGVRILHEAGV
FT                   PASALQLLPGDGRVGAALVAAPQTAGVMFTGSTEVARLIQAQLADRLSPAGRPIPLIAE
FT                   TGGQNAMIVDSSALAEQVVGDVIASAFDSAGQRCSALRVLCLQEDIADRTLAMLKGALH
FT                   ELNIGRTDRLSVDVGPVISAEAKDIIETHIERMRGLGRKVEQIGLAAETEAGTFVPPTI
FT                   IELEKLADLQREVFGPVLHVIRYRRDNLDRLIDDINATGYGLTFGLHTRLDETIAHVTS
FT                   RIKAGNLYVNRNIIGAVVGVQPFGGRGLSGTGPKAGGPLYLGRLVTPAPVPPQHSSVHI
FT                   DPTLLDFAKWLDGKGATAEAETARNAGSSSALGLDLELPGPVGERNLYALHPRGRVLLV
FT                   PATESGLYHQLAAALATGNSVVVDAACGLQASLKSLPHSVALRVSWSKDWAADGPFAGA
FT                   LVEGDAERIRQVNKAIAALPGPLVLVQAASGEEIARNPDAYCLNWLVEEVSTSINTAAA
FT                   GGNASLMTIG"
FT   gene            complement(107866..108180)
FT                   /locus_tag="NGR_c00990"
FT   CDS_pept        complement(107866..108180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c00990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00990"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23902"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF65"
FT                   /protein_id="ACP23902.1"
FT                   /translation="MTSALSPHHDFDCQSCGACCAYSAEWPRFSLETEEELEQIPADHV
FT                   AADLGGMRCENDRCTALEGTLGKFVACKVYAVRPIVCRTCMPGDDECLMARQRLFGAAA
FT                   "
FT   gene            complement(108249..109055)
FT                   /locus_tag="NGR_c01000"
FT   CDS_pept        complement(108249..109055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01000"
FT                   /product="predicted metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01000"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23903"
FT                   /db_xref="GOA:C3MF66"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF66"
FT                   /protein_id="ACP23903.1"
FT                   /translation="MTKFIIFTDLHMVPEGMSIIGIDPYRRLAAGIQHVNRYHADADRV
FT                   IFAGDLAHGADRASYERLKALLGELDPPAAIMIGNHDRREAFLEVFDEAATDASGFVQQ
FT                   VIDFADCRAILLDTLFAPPYDYPVSHAGYLCDRRLAWLDRQLASAADRPVLIFMHHPPH
FT                   ITGFIGIDMFRLINEEDFYGLVRRHGNVRHIFAGHVHRTISGSSRGIPFSVFKSPVHQQ
FT                   PMPFDIPDASLSVDEPAAYGIALVTRDGVLVHTEDYEIAKRDAAVA"
FT   gene            109220..110284
FT                   /locus_tag="NGR_c01010"
FT   CDS_pept        109220..110284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01010"
FT                   /product="proline racemase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01010"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23904"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF67"
FT                   /protein_id="ACP23904.1"
FT                   /translation="MPLTLVRRTVMRWKRTIQLLDVHCEGEIGKVAIGGVPKIPGNSIA
FT                   EQLNHINTVDDSLRRFLCLEPRAASIGSVNLLLPPKRPEADAGFIILQADQAHAMSGSN
FT                   SICVTTALLESGMIEMKEPETVVMLDTAAGLVKATATCREGRCERVKLTMVPSFVQELD
FT                   VVVDTPEWGRIKVDLCFGGVFYALVDVRQIGTTIDKTNARRIVEAGMALKDIVNRTLPV
FT                   VHPEIPEIKGVAYVMFRDTEADGAVRTCTTMWPGRVDRSPCGTGSSANLATLHARGKVK
FT                   PGDVLTSRSIIGSEFEVGLEAVTTVAGRKAIIPTISGRGWTFGLHQVALDPFDPLADGF
FT                   ALTDTWGPQAGEIR"
FT   gene            complement(110324..110887)
FT                   /locus_tag="NGR_c01020"
FT   CDS_pept        complement(110324..110887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01020"
FT                   /product="hypothetical protein contains Sel1-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01020"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23905"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF68"
FT                   /protein_id="ACP23905.1"
FT                   /translation="MDTRINPTIGRANALLLATAVLLSFAAVAAPSAHAADLTAAEQCD
FT                   REAGSELDLERNRAFPAVATQEIRIGVALSACREAYNQSGGARTQFQLARVLDRAGEKL
FT                   KSLQLLGEAAQNGHALAMAMYGIRLVERGEAEAAFDLYQRAAAAGNVVAARNLAVAYRD
FT                   GVGTRADGALAAQWFARAQTSKLQ"
FT   gene            111186..111806
FT                   /locus_tag="NGR_c01030"
FT   CDS_pept        111186..111806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01030"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23906"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF69"
FT                   /protein_id="ACP23906.1"
FT                   /translation="MPQLHINRRMVLGGLILAVVGCRTATAATGAVVGKAQKIRGNVRR
FT                   RQGDADERLAAGGAVLDRDYVTTSTNSFADLALSETRILLGPQTELLIDSFIAGEGGTL
FT                   ELGVGRMVFDRPQGLPKVDMAIRTAFGMIGVRGTKFFCGPSRAAAFAVFVEHGAVSVEG
FT                   GGIARRLTAGEGVDFDRPGGAPGEVTRWGQARIREAYASVGLR"
FT   gene            complement(111798..113681)
FT                   /locus_tag="NGR_c01040"
FT   CDS_pept        complement(111798..113681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01040"
FT                   /product="putative adenylyl / guanylyl cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01040"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23907"
FT                   /db_xref="GOA:C3MF70"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF70"
FT                   /protein_id="ACP23907.1"
FT                   /translation="MSQTPWPHRRISPLAGGIVASLATALLLYLYAETAFRTPRELFFD
FT                   NLTQWVSSPRSADIVVVDIDRVAYEARSENWDRGATAELIARLAAARPKAIAVDFVFSS
FT                   DCDPASPANSALASAIGEAPVVLGFLAAARSLERPRPVPPLAFRRQLAVPEQWFTQGAE
FT                   TACPIFMDRSKAATAAFLVGDKDARVRRTQAFAIVDNDAFPALGIEAGRLGAASSTPVL
FT                   GGEPAWLRLDHAIIPLDADGNLRFVASSQAALAARTVSAADVLAGRIDESRIAGKLVFL
FT                   GSSMPSLGGLRPTASMPLEPSVQIHADIANAVVTGFVPYRGGDQPLIEALFSVTTGVVA
FT                   AYGATKLRPGMTLTLGAAAVLAIGAFAGAIYAATGWLFDAVGISVALVTILVVTSALQL
FT                   ARVRRAEAIARQKFSQYLPQSVVSRYIDDPDRGRVAGEERPVTALFTDIEGFSILSQKL
FT                   APRELVALLDTYFAEVNALVSRHGGMVDKVVGDAVHSLFNAPEDLADHVDKAIQCAVAI
FT                   NALTEEMRLRPQFAKHDFGRTRIGIETGPAVLGEVGAGGKLDYTAHGDAVSLAARLQEA
FT                   NKFLGTAICIGPAAAAQCKIALRALGQHEIRSFGSMELFTVANAGGLRTSA"
FT   gene            complement(113687..114391)
FT                   /locus_tag="NGR_c01050"
FT   CDS_pept        complement(113687..114391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01050"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01050"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23908"
FT                   /db_xref="GOA:C3MF71"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF71"
FT                   /protein_id="ACP23908.1"
FT                   /translation="MTEINRSPAFWRSFPIFEEFDKETLCELADIASYRKWPAGTVIFQ
FT                   RGDEGNYMIVVVSGRIKLSLFTPQGRELMLRQHEAGALFGEMAVLDDQPRSADAAAVTA
FT                   AEGYVIGKKAFLDLITQKPRIAEAVIRFLCAQLRDTTDRLETIALYDLNARVARFFLAT
FT                   LRQIHGNELPASANLRLTLSQTDIAAILGASRPKVNRAILWLEEHGALKRTDGIVSCNV
FT                   GRLLMIADPPED"
FT   gene            114713..115150
FT                   /locus_tag="NGR_c01060"
FT   CDS_pept        114713..115150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01060"
FT                   /product="putative membrane protein contains DoxX family
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01060"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23909"
FT                   /db_xref="GOA:C3MF72"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF72"
FT                   /protein_id="ACP23909.1"
FT                   /translation="MPLNVIVLVGRVLLSIMFITSGFGKLADPAGTAGMIANAGWPAAT
FT                   ALAYLAGLFELVAGLAVLVGFQTRIASYLLAAFCLVTAFVFHSGPINVPDFPAAANGLL
FT                   SMFNQIMMMKNITLAGAFLVLAGFGPGALSLDARLGRTVAA"
FT   gene            115492..115758
FT                   /locus_tag="NGR_c01070"
FT   CDS_pept        115492..115758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01070"
FT                   /product="putative transposase for insertion sequence
FT                   NGRIS-12b"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01070"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23910"
FT                   /db_xref="GOA:C3MF73"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF73"
FT                   /protein_id="ACP23910.1"
FT                   /translation="MPDHVHMLISIPPKYSVSHIVGFLKGKTALYVANKYARKRRYKGY
FT                   HFWARGYFVSTAGYDEQVVRRYIRNQEKADKASDFADLFNRSY"
FT   gene            complement(115845..116273)
FT                   /locus_tag="NGR_c01080"
FT   CDS_pept        complement(115845..116273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01080"
FT                   /product="putative RbsD/FucU transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01080"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23911"
FT                   /db_xref="GOA:C3MF74"
FT                   /db_xref="InterPro:IPR007721"
FT                   /db_xref="InterPro:IPR023750"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF74"
FT                   /protein_id="ACP23911.1"
FT                   /translation="MLKGIDPILSPELLAALRAMGHGDEIALVDGNYPGQEHARRLVRL
FT                   DGHHLIPALDAILSVLPIDDFVPEAIFRATVKQDKDALDPVHRDIIACCRKHEPNQPVV
FT                   PLLGTEFYPRVRAAHTVVQTSEPRLYGNVILRKGVVYP"
FT   gene            complement(116274..117506)
FT                   /locus_tag="NGR_c01090"
FT   CDS_pept        complement(116274..117506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01090"
FT                   /product="putative ROK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01090"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23912"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF75"
FT                   /protein_id="ACP23912.1"
FT                   /translation="MSLTEDPHGGSAQPDVIDPSGGANQTRVRAYNERLVMSLVRRHGS
FT                   LSKAEIARRSGLSAQTVSVIMRALEADGMLIRGAPVRGRVGQPSIPMRLNPDAVYSFGV
FT                   KIGRRSADLVLMDFLGNIRLHLHQIHTYPLPGDLVTFIVKGIEKLEEKLGPEERKRIAG
FT                   VGIATPFELWNWAEEVGAPHEEMDKWHDFDLQAAVAARTRHPVFLQNDGTSACGAELAF
FT                   GVGASYPDFVYFYIGSFIGGGVVLNSALFSGRTGTAGAVGPLPVSGKDGKTTQLLKIAS
FT                   VFVLEKLLRERGMDPKPLWYSADDWIDFGEPLEVWIQDSAAALAQAVVSAVSIVDFSAA
FT                   VIDGGFPPWVRARLLTATRKALQTLDLQGVTLPDLVEGVVGSHARAIGGASLPLFSRYL
FT                   LDTNVLFKELT"
FT   gene            117773..118798
FT                   /locus_tag="NGR_c01100"
FT   CDS_pept        117773..118798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01100"
FT                   /product="periplasmic binding protein/LacI
FT                   transcriptionalregulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01100"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23913"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF76"
FT                   /protein_id="ACP23913.1"
FT                   /translation="MKKTVLSTAFGALALGVAFASPSQAADVSACLITKTDTNPFFVKM
FT                   KEGASAKAQELGVTLKAYAGKVDGDHDSQVAAIESCIADGAKGILIAASDTKAIVDQVK
FT                   KAQAAGVLVIALDTPLDPATAADATFATDNLLAGKLIGQWAAATMGENAKTAKIGFLDL
FT                   TPSQPTVDVLRDQGFMIGFGIDPKDPNKIGDEDDPRIVGHDVTNGNEEGGRTAMENLLQ
FT                   KDPDINVIHTINEPAAVGAYQALKAVGKEKDVLIVSVDGGCPGVKSVTEGVIGATSQQY
FT                   PLMMAALGIEAIKKFAETGEKPKPTEGKDFFDTGVALVTDKPAAGVESIDTKVGTEKCW
FT                   G"
FT   gene            119099..120184
FT                   /locus_tag="NGR_c01110"
FT   CDS_pept        119099..120184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01110"
FT                   /product="putative ribose transport system, inner-membrane
FT                   translocator"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01110"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23914"
FT                   /db_xref="GOA:C3MF77"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF77"
FT                   /protein_id="ACP23914.1"
FT                   /translation="MGEPNTAAQPSQEFEKVLVNSSTDVASFDTHDKTPLQKIQHFLHS
FT                   TPAAVPFVVLIASILVFGLAIGGRFFSSYTLTLILQQIAVVGMLGAAQTLVILTAGIDL
FT                   SIGVIMVISAVVMGNCAVSYGLPAPIAVAAGFLVGGACGLLNGLLVSRLKLPPFIVTLG
FT                   TWYVVMSTNFIYSENATIREADVTAVTQWLHVFGVTFKVGAAVLTLGVVAMVVLVFGLW
FT                   YALNHTAWGRHLYAVGDDPEAAKLSGIRVGKVLLSAYTLAGLIAALAAWVSIGRNGSIS
FT                   PSAAVTDYNLQAITAAVIGGISLFGGRGSILGTLIGAMIVGVVSMGLNMLGADPQWKVF
FT                   LTGVLIISAVAIDQWIRKVAA"
FT   gene            120184..120966
FT                   /locus_tag="NGR_c01120"
FT   CDS_pept        120184..120966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01120"
FT                   /product="predicted sugar ABC transporter, ATP binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01120"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23915"
FT                   /db_xref="GOA:C3MF78"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF78"
FT                   /protein_id="ACP23915.1"
FT                   /translation="MAQEPILTARGLVKRYGRVTALDHADFDLYPGEILAVIGDNGAGK
FT                   SSMIKAISGAVTPDEGEIRLEGQPVHFRSPMDARAAGIETVYQNLALSPALSIADNMFL
FT                   GREIRKPGIMGKLFRTLDRSAMEKRAREKLSELGLMTIQNINQAVETLSGGQRQGVAVA
FT                   RAAAFGSKVVIMDEPTAALGVKESRRVLELILDVRRRGLPIVLISHNMPHVFEVADRIH
FT                   VHRLGRRLCVINPKEYTMSDAVAFMTGAKAPPGEALAA"
FT   gene            120963..121583
FT                   /locus_tag="NGR_c01130"
FT   CDS_pept        120963..121583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01130"
FT                   /product="conserved hypothetical protein contains uridine
FT                   kinase related domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01130"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23916"
FT                   /db_xref="GOA:C3MF79"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF79"
FT                   /protein_id="ACP23916.1"
FT                   /translation="MNVQSLTDEILKRAAGAGRFIVAIAGPPGAGKSTLSEALAAAIAE
FT                   TGENVAVLPMDGFHMDNAVLVEKGLLQRKGAPETFDVRAFLSTLAAVRANDGEVLVPVF
FT                   DRTRELAIASARTIAAETRIVLVEGNYLLLDEVPWSGLDGAFDYSIFIDPGIDVLEQRL
FT                   LQRWHDHGYDEETARTKAFDNDIPNARRVVGSRRASDLVIRDF"
FT   gene            121732..122769
FT                   /gene="pyrC"
FT                   /locus_tag="NGR_c01140"
FT   CDS_pept        121732..122769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="NGR_c01140"
FT                   /product="dihydroorotase, homodimeric type"
FT                   /EC_number="3.5.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01140"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23917"
FT                   /db_xref="GOA:C3MF80"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004721"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MF80"
FT                   /protein_id="ACP23917.1"
FT                   /translation="MQELVIRRPDDWHLHLRDGGVLRGVIGDTSRHFARAIVMPNLVPP
FT                   VVTSADAAAYRQRILAAIPAGDRFEPLMTLYLTEGTDPDDVEAGYGSGLVKAVKLYPAG
FT                   ATTNSHSGVRDIAKAMPVLERMAEIGMPLCVHGEVTTPEVDIFDREAVFIETVLDPLRR
FT                   RLPDLRITMEHVTTKDGVDYIKEHAGNLAGSITTHHLIINRNAILVGGIKPHYYCLPVA
FT                   KRERHRQALRAAAVSGDVRFFLGTDSAPHVDPLKECACGCAGIYTSVNTMSCLAHVFEE
FT                   EGALDRLEAFTSLNGPAWYGLPANEETITLRKANEPVRYPAKIETEAGLITVFDPLFPL
FT                   YWAVA"
FT   gene            122794..123492
FT                   /gene="pyrE"
FT                   /locus_tag="NGR_c01150"
FT   CDS_pept        122794..123492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="NGR_c01150"
FT                   /product="orotate phosphoribosyl transferase"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01150"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23918"
FT                   /db_xref="GOA:C3MF81"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MF81"
FT                   /protein_id="ACP23918.1"
FT                   /translation="MFSNAFTDKTVMAELVAKMLWEIKAVHFRADEPYKLSSGMASPVY
FT                   IDCRKLISYPRIRSAVMDFAAATILRDAGFEQFDVVAGGETAGIPFAAMLAERLGLPMI
FT                   YVRKAPKGHGRNAQIEGHMPEGARVLVIEDLTTAGGSMFKFIDAIRAAGGIVEHGIALF
FT                   YYDIFPEARGNMKSKGVDLHYIATWRNVLAVAREQALFDEKTLNEVEAFLNAPLAWSER
FT                   NGGVGTLAAQ"
FT   gene            123551..124477
FT                   /locus_tag="NGR_c01160"
FT   CDS_pept        123551..124477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01160"
FT                   /product="fructokinase protein"
FT                   /EC_number="2.7.1.4"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01160"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23919"
FT                   /db_xref="GOA:C3MF82"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF82"
FT                   /protein_id="ACP23919.1"
FT                   /translation="MIVCCGEALIDMLPRETAAGESAFAPYAGGAIFNTAIALGRLGIP
FT                   TGFFTGLSDDMFGDILRETLKAANVDFGPCATLPLHTTLAFVKLVHGHASYAFFDENTA
FT                   GRMITTEHLPALGDFCEALHFGAISLIPEPCGSTYEALMTREHEKRVISFDPNIRPGFI
FT                   TDREAHLARMNRMAAMSDIIKFSDEDLAWFGMEGSHDALAAEWLKRGPKLVLITRGADG
FT                   AVGYTKNHKVEVASERVTVVDTVGAGDTFDAGVLAALKLNNLLTKEQVANLSDEAVRQA
FT                   LALGAKAAAVTVSRAGANPPWKYEIGL"
FT   gene            complement(124810..126435)
FT                   /gene="pgi"
FT                   /locus_tag="NGR_c01170"
FT   CDS_pept        complement(124810..126435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="NGR_c01170"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01170"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23920"
FT                   /db_xref="GOA:C3MF83"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF83"
FT                   /protein_id="ACP23920.1"
FT                   /translation="MKALVETLKATARETNATDIRAAFAADPNRFSRFSTRLDDLLLDY
FT                   SKCAVNDKVLDGLEALAKAAKVEEKRDAMFRGDIINITEERAVLHTALRNRSNRPILVA
FT                   GKDVMPDVNAVLEAMGAFADDVRSGALKGATGKKITDVVNIGIGGSDLGPVMATLALAP
FT                   FHDGPRLHFVSNVDGAHIADTLKLLDPETSLFIVASKTFTTIETMTNAATARAFIAGKL
FT                   GEAAVGNHFAAVSTALDKVAAFGIDAARVFGFWDWVGGRYSIWSAIGLPLMIAVGSENF
FT                   GRFLDGGHAIDEHFRTAPVRENLPVLLGLIGFYHRNVLGYPSRAILPYDQRLSRFPAYL
FT                   QQLDMESNGKAVTLDSKPVEFATGPVVWGEPGTNGQHAFYQLIHQGTDIIPAEFMIAAN
FT                   GHEKDLRHQHQLLIANCLAQSEALMKGRTLTEAKAQLTSKGMDEAKADKIAPHRVFTGN
FT                   RPSLTFVYDQLDPFAFGRLIALYEHRVFVEGALFNINSFDQWGVELGKELATGLLPVVE
FT                   GKESAAGHDSSTAGLVDALLKAAR"
FT   gene            complement(126754..128454)
FT                   /gene="fadD"
FT                   /locus_tag="NGR_c01180"
FT   CDS_pept        complement(126754..128454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="NGR_c01180"
FT                   /product="long-chain-fatty-acid-CoA-ligase"
FT                   /EC_number="6.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01180"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23921"
FT                   /db_xref="GOA:C3MF84"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF84"
FT                   /protein_id="ACP23921.1"
FT                   /translation="MAEASMQQAGSGAAKNWVKSYPPGVPAEIGPLPYRSLGEFFDHAV
FT                   AQHSWRPAFTCMGKSLTFADLNVQSGRIGAWLQSLGLAKGDRVAVMMPNILQNPVIVYG
FT                   ILRAGYTVVNVNPLYTPRELEHQLVDAGAKAIFVLENFAHTVEQVVARTKVKHVVVATM
FT                   GDMLGVKGLLVNLVVRRVKKLVPAWSLPGHVSFRSVLAKGEKLQLAKPNVGPGDVAFLQ
FT                   YTGGTTGVSKGATLTHANLLSNMAQMELWLNTAFLRKPRPDNLTFMCALPLYHIFALTV
FT                   NSLMGLATGGNNILIPNPRDIPAFVAELGKYKTNIFPGLNTLFNALMNNPEFQKLDFAS
FT                   LILTFGGGMAVQRPVAERWLAMTHCPIHEGYGLSETSPVATANRLDTDEFTGTIGMPLP
FT                   STEVEIRDENGNSLPTGEIGEICIRGPQVMAGYWQRPDETAKAISPDGFFRTGDIGFMN
FT                   AAGLTKIVDRKKDMILVSGFNVFPNEIEEVVATHPGILECAAIGIADPHSGEAVKLFVV
FT                   RKDPNLTEEDVKRHCAENLTNYKRPRHVEFRDELPKSNVGKILRKDLRG"
FT   gene            128845..130020
FT                   /locus_tag="NGR_c01190"
FT   CDS_pept        128845..130020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01190"
FT                   /product="predicted transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01190"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23922"
FT                   /db_xref="GOA:C3MF85"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF85"
FT                   /protein_id="ACP23922.1"
FT                   /translation="MQLGNRERENPPVEPRLFGQPAHSRSALVLPISAARWMLVLILLA
FT                   GVYFFHGFVVPVLAAVVIGFASWPIYRRLLQALNGNRTLAATIAIISVIAFIVVPISIA
FT                   AAYAIDEVRDWLVWAVETNVNGAPVPAWLTTIPVAGAWLGQQWVKYVGHPGALGELVQL
FT                   VSGSNIGNIYRGVLVIGASAFQSFLTLLFMLITLFFVYRDGHSFSKQLDRLGEQIFPMR
FT                   WERLSRVVPLTISSTVTGMGIIAIGEGIVLGVAYWLAGVPSPVTLGIITGLMALIPGGA
FT                   PLCFTLVSIYLVASGSPFHGVALFAWGTTELFIVDKTLRPRLVGGPIKLPFLPTFFGLV
FT                   GGVKTMGFLGLFVGPVLMALLVAIWREWMHEVANQPEPTANPISRVDIAAK"
FT   gene            130126..132810
FT                   /locus_tag="NGR_c01200"
FT   CDS_pept        130126..132810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01200"
FT                   /product="osmosensitive K+ channel signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01200"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23923"
FT                   /db_xref="GOA:C3MF86"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF86"
FT                   /protein_id="ACP23923.1"
FT                   /translation="MPEIDRDPASRPDPDALLALAEKGGRGKLTVFLGAAPGVGKTYAM
FT                   LMRAQRLKEEGADIVIGLVETHGRSETAALLEGLEVLPRREVAHGGRTLHEFDLDAALA
FT                   RHPRIIVVDELAHTNFGESRHPKRYQDIEELVDAGIDVWTALNIQHLESLSDIVAQIAG
FT                   VPVRERIPDTVLNRADEVLLVDLPPAELIDRLKEGKVYLPDSAKRAVDNFFRLGNLTAL
FT                   RELALRRTADRVDDQMVDYLKQNAIEGPWPASERLLVCIGPDPLSEKVVRTASRLASGL
FT                   NADWIVVSVERADREAADGEAMRQLDETFRLAEQLGAETRRIIGSDFVEEILKLARREN
FT                   ATQIVIGARRHRFPLNLFRASLPDALAKRVSGIGIHLVTGKIEPVARTRRRSKQLLPEG
FT                   LERALAIAGGTVGLATVLGLLIEQFIILQNISLLYLLAVLASAVYAGYFAALAAALFSV
FT                   VAYNFFFIEPVNTFTVAEPHEVFALFVFLAAAALAGGLASRIREQAKTARNRATATQAL
FT                   YDFSRKLSGTANADDVLWAAVTQMQSTLRRNAVMLLPEDGDIALRAAWPPDTELTVSDM
FT                   IAARWAFEKKEAAGNDTGTLPNSPFQFRPLMSPQGVVGVCGFLQEDSPLEINEERALAA
FT                   ILDQTAIAVDRARLSRESLDQAAQLEGEKFRAALLSSLSHDLTTPLATIGSAVISLRQL
FT                   GEGTPKDAREDLLKSIEEESGRLTRFVTNLLDMNRIEAGTINARRDRVDVAEVVHDAVE
FT                   RARKYFPGRVFETSIALGLPAMRGDGVLLGQVLFNLLDNANRFGGDEPVSIYARREGDE
FT                   VVLSVTDLGKGIAPADLEHVFDKFFRKGKPDGRSLGTGLGLTISRSFVEAMGGRIKAES
FT                   PALRRRGTRISMRFPAAEAELSN"
FT   gene            132895..133560
FT                   /locus_tag="NGR_c01210"
FT   CDS_pept        132895..133560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01210"
FT                   /product="putative CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01210"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23924"
FT                   /db_xref="GOA:C3MF87"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF87"
FT                   /protein_id="ACP23924.1"
FT                   /translation="MNVASDGGEPGGPGADRRPIAARDSGFARRLTALLLKTPITPNEI
FT                   SLLSVGFAAIGAAALLYATRWPFLYLVAVAGIQLRLLCNLLDGMVAVEGGRGSPVGALY
FT                   NEFPDRVADTLLIVALGYAAGAGWLGWAGALAAALTAYVRVFGGSLGQAQVFRGPMAKQ
FT                   HRMALMSLACLLALGEALLTSERFVLYTAGWIILAGSLITCWTRTRAIVSRIPGAAKP"
FT   gene            133557..134168
FT                   /locus_tag="NGR_c01220"
FT   CDS_pept        133557..134168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01220"
FT                   /product="putative 1-acyl-sn-glycerol-3-phosphate
FT                   acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01220"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23925"
FT                   /db_xref="GOA:C3MF88"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF88"
FT                   /protein_id="ACP23925.1"
FT                   /translation="MIDLLLIGLTRFIVGGQALWIGASPETRQRIYFANHASHLDTLLI
FT                   WSALPRPLRGTTHPIAASDYWGRGKVRRHIALKVLNAVLVDRVTHGPPGAALAPLRGVL
FT                   AEGESLVLFPEGTRGNERLPGPFKSGLYWLAQEFPEVELIPTYLDNPSRAFPKGTFLPV
FT                   PISCTVRFGAPLPRRPGEEKEAFLERARAAVGALASDPAL"
FT   gene            134176..135003
FT                   /locus_tag="NGR_c01230"
FT   CDS_pept        134176..135003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01230"
FT                   /product="predicted phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01230"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23926"
FT                   /db_xref="GOA:C3MF89"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF89"
FT                   /protein_id="ACP23926.1"
FT                   /translation="MSLTDKLFILFGGICALLGIASAIGFVLSRQVTSENGRATVDNLN
FT                   ARIKAWWVMVAIFAVSFGLGRGVTVVLFALTSFYTLREFVSLTPTRGADHLPLVAAFYL
FT                   LLPLQYWLIWTDWYALFTILIPVYGFLLLPSLAALKGDAGEFLLRVSRIQWGLMLTVYC
FT                   ISHAPALLTLDIPGRPREGFLLLFFLITVAQFSDVMQYVFGKLFGRTKVAPVISPSKTV
FT                   EGLIGGGPPLPPGPASGGSPRSRRLKPPPWRSPSSPWASSAAYRSRPSSARWA"
FT   gene            complement(135218..135709)
FT                   /locus_tag="NGR_c01240"
FT   CDS_pept        complement(135218..135709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01240"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23927"
FT                   /db_xref="InterPro:IPR016541"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF90"
FT                   /protein_id="ACP23927.1"
FT                   /translation="MIYIVDTSSLRELERYYNDIFPTFWKLFQAEVDSGSVVSVREVLR
FT                   ELEACPETNVIAWAKHNSGIFKPPAPAEAAFVGQIFALPHFQQLISSKAQMTGQPVADP
FT                   FLIAAAKVCSGTVVTQERFKPNSAKIPNVCERHRVHDFRGFLEGQALEFLANVTWGWDT
FT                   "
FT   gene            complement(135706..136875)
FT                   /locus_tag="NGR_c01250"
FT   CDS_pept        complement(135706..136875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01250"
FT                   /product="conserved hypothetical protein contains
FT                   helix-turn-helix type 3 domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01250"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23928"
FT                   /db_xref="GOA:C3MF91"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF91"
FT                   /protein_id="ACP23928.1"
FT                   /translation="MPGIQPALLKWARESAHLSTEEVAGRLKKSVEEIDAWESGTDAPS
FT                   YAQLEKLAYELYKRPLAIFFLPSPPKEPRPEAEFRALPDSDLRNLRRDTVLLIRRARAY
FT                   QASLIELFGGSSPTAEPLWKQVEIDASRPSARQAAVVRASLGVPAPGAREWGAPDGDEA
FT                   LKIWRKAVEARGVFVFKDTFKQSEISGFCLEHSELPIVVINNSTTKTRQIFSLLHELAH
FT                   VLMGRRAISTFDEAPLNRLSPAEQRIERFCNQIAADILVPPDDFAAQVSGLPQNVEALP
FT                   SDAFAALAARYRVSREVILRRFRDADRVSQAFYEKRKREWDGQKIHKGSSGGSFYSTKG
FT                   AYLSERLMSEVFARYGRRQINVDEAAEFIGVKPKQVDELESRFLRGMAA"
FT   gene            137338..138546
FT                   /locus_tag="NGR_c01260"
FT   CDS_pept        137338..138546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01260"
FT                   /product="phage integrase-like protein contains catalytic
FT                   core domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01260"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23929"
FT                   /db_xref="GOA:C3MF92"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF92"
FT                   /protein_id="ACP23929.1"
FT                   /translation="MARPLNKLTAVAVKNASAGKHSDGGGLWLHKREDGGSQWILRVNV
FT                   HGRRREMGLGSASDVSLKEAREAAERWRALVRSGLDPIKERQRQRREAARNLHCLDDIA
FT                   RDAFESRKAELKGDGIAGRWFSPLEIHVLPKLGKVPVVDIDQTDIRDVLAPIWHSKAET
FT                   ARKALNRLAICLKHAAALGLDVDLQATDKARALLGKQRHKIENIPAMPWQDVPGFFASL
FT                   SDGSVTHLALRLLILTGVRSGPLRFLRDEQINGDVWTIPGEAMKGRKGATADFRVPLSD
FT                   AALAVVEQARQHARDGFLFPSLRKGVISDATMSRLMERAGMEARPHGFRSSLRDWIAEA
FT                   TDTPHDIAETTLGHIVGGAVERAYRRTDFLEQRRQLMARWARHVTGQSGQVITLAKRNH
FT                   SEP"
FT   gene            138536..139396
FT                   /locus_tag="NGR_c01270"
FT   CDS_pept        138536..139396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01270"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01270"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23930"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF93"
FT                   /protein_id="ACP23930.1"
FT                   /translation="MNREFDKAMEAWRLPDELSVVDAAILITGNDPSAEHEVYDHKMRR
FT                   AFLEQVTTGHRGFEAAFSALRSAILANKLQARVVFSVDVERAELRAVVRGSRQISELSG
FT                   QLLSHCADAVSLQWEPDWKQTTVEVKELRRWLESRNHRPPFFFPTTETQPEPRPKVRDF
FT                   MDRTHLRYSAKLACAVAAWEALADLPKSKAVKDAICDWVAEHGERYAKPGDRNGFGAAG
FT                   KVTGSALDQIASVVNWKPQGGAPRTGGEVSGKSGQVPNSGVGPARQDQKMQPLDDEGGE
FT                   EPPFL"
FT   gene            139552..139749
FT                   /locus_tag="NGR_c01280"
FT   CDS_pept        139552..139749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01280"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23931"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF94"
FT                   /protein_id="ACP23931.1"
FT                   /translation="MQLTDPLLTVRESAEVLQISVPTFWRRVADGTVPRPVKIGALSRW
FT                   PYSEIIAVIERAKNSRSDVA"
FT   gene            139921..140214
FT                   /locus_tag="NGR_c01290"
FT   CDS_pept        139921..140214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01290"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23932"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF95"
FT                   /protein_id="ACP23932.1"
FT                   /translation="MSKVFLTIRRLPDGAPHTMRGRPAWALELLIDAGSAGCTPITDPG
FT                   PRWSSYVHILRKRSGLVIDTLRETHDGQFPGTHARYVLRSPVEVLRSWRDVK"
FT   gene            140324..140821
FT                   /locus_tag="NGR_c01300"
FT   CDS_pept        140324..140821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01300"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23933"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF96"
FT                   /protein_id="ACP23933.1"
FT                   /translation="MTNINLRDHSHTSGRAEKKPRWLTQFIGHRLEMLLSPAWQDAPRP
FT                   LARLIERLEIEHLRHGGQNNGELYVSYAQFAAYGISKRVICRTLKLGEDLGLIEVIRGE
FT                   GIIRGDIRPENAYRLTFVPAKNRKSPTDEWKQISKARAKDLVTAYRADEKRATNTARRA
FT                   AA"
FT   gene            complement(142074..142328)
FT                   /locus_tag="NGR_c01310"
FT   CDS_pept        complement(142074..142328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01310"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23934"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF97"
FT                   /protein_id="ACP23934.1"
FT                   /translation="MSVEPEYDPDWDSPEAIAKWRVRGIRNIYERAKEFHRIKAELEME
FT                   ISTARETLVRKPLMREDEIEAATQRAYDALQDRKAKDQS"
FT   gene            complement(142330..142854)
FT                   /locus_tag="NGR_c01320"
FT   CDS_pept        complement(142330..142854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01320"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23935"
FT                   /db_xref="GOA:C3MF98"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF98"
FT                   /protein_id="ACP23935.1"
FT                   /translation="MNEKLAPFVLVSQPTSLRRHWLVYVSAVFFGLIACAAIQQSWGEG
FT                   LGAILIPAAIGYFVVKGGKSVPGLLVRYSIFMLGFMFVISGLAISEITEAHDGVKTSCL
FT                   TKNDYTAQLTTEKRTQYCQCMSDTLDAAIVWSTSTSFLAFKPLTGKIQDVPELMNLATK
FT                   RANECAVQMGG"
FT   gene            143676..147098
FT                   /locus_tag="NGR_c01330"
FT   CDS_pept        143676..147098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01330"
FT                   /product="putative restriction endonuclease type I with R
FT                   subunit / type III with Res subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01330"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23936"
FT                   /db_xref="GOA:C3MF99"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025285"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MF99"
FT                   /protein_id="ACP23936.1"
FT                   /translation="MGGALSVNFDHLKSLSPELQRLGTLAERFFADDANTSLIKSRQFG
FT                   EYMVKEIAALSGVYDPAARETTHDLLRRLATQQILPREVADIFHAVRKSGNEATHNLAG
FT                   SPTEALAALKFCRALGVWYRRTYGRDPNFRPGPFVPPKASADIDQATQAELATLRRQVR
FT                   EAEAQLAAAHSSADELAKARAAADELARQAAADNAVWEQTAVEMEANQAELSRKLAELQ
FT                   KAAQAQPQQLQMEFKQAGLQAASRLELDERQTRRLIDAQLVDAGWEADSDRLSYQLGAR
FT                   PEEGRNLAIAEWPAAGGRADYGLFIGLTCVGIIEAKRESVDVPSTLQQAERYARTIALP
FT                   PENSHPGGLWNHGLADPFRVPFVFTTNGRPFVRQWQTKSGIWFCDLRRDTNHPRPLTTW
FT                   FSPKDLLDILATDLDAAAQGLAEDSFGKGRMRPYQEDAIAAIENAVVAGQRDILVSMAT
FT                   GTGKTRTSIALMYRLLKHKRFRRILFLVDRKALGKQTSDALETTEIEGMLNFAQIYKVA
FT                   GLEKKVPEDEDQVQVATVQSLIARILNEPDPAKRPTPGTFDCIIVDEAHRGYTLDAELR
FT                   ESDVGFRNLDDYQSAYRQILDYFDAVKVALTATPALHTREIFGHPVFHYGYRQAVVEGY
FT                   LNDHLPPKRITTALSEAGIHFEGGEEVEIIDRTTGQIDLFELPDEVSLDYDVADFNKRV
FT                   YSEAFNRMVCRAIATEIPPSKPGKTLIFAARDAHADDLVRLLVEELQEEYGNDAVPHGM
FT                   VMKITGNVDKADDLILKFKNDPHPKYVVTVDLLTTGIDVPTICNLVFVRRVKSRILYDQ
FT                   MIGRATRLCPEIGKEHFRIFDAVDLYAELQEMTDMRPVVVKPDISLGQLVTDLDKAETE
FT                   EDKSWVAGQVIVRMRAMANRMDAETRESFERHTGETPENAVQRLATLSGSELQDWLKSH
FT                   PRVIELLERRPIRTGSGNDGVVISTHEDELLRIEEIFGKNTTPEDYITGFERFIRENMN
FT                   QVPALIAVTQRPRDLTRKELSELAGLLDEKNYSEAMLRAAYGKVRNADIAAHIIGFVRQ
FT                   AAIGDPLIPYATRVENAIGKIEASRPWTQKQKEWLRRIGRALKDKPVADPTLLDQGVFA
FT                   DKGGFKRISQEFDGELDDVLHAFNEAIWAPPAA"
FT   gene            147165..148700
FT                   /locus_tag="NGR_c01340"
FT   CDS_pept        147165..148700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01340"
FT                   /product="N-6 DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01340"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23937"
FT                   /db_xref="GOA:C3MFA0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFA0"
FT                   /protein_id="ACP23937.1"
FT                   /translation="MNANAIVQKLWRLCTVLRKDGITYQQYVTELTYLLFLKMMAERNR
FT                   ESGSLPETMRWEDLVQANGLAKLELYRRTLVTLGTVSTRLGKDDALVLPPGDNATPDER
FT                   KRYVDARPLPDMVQEIFDNASTFIREPQNLTTLVTAIDELDWFSEERDQFGDLYEGLLQ
FT                   KNAEETKRGAGQYFTPRVLIRVLVRLMQPQPGEVIQDPAGGTGGFLIAADHYMRARTDN
FT                   YFDLGEKEQEFQKRHAFHGMENVPGTLRLLLMNLYLHDIDSDHVDLGDTLSDKGKGLGR
FT                   ANLILTNPPFGPAGGAPTRDDLSVTATVSSYQLPFVEHCIRALKPGGRAAIVVPDNVLF
FT                   EDGRGRQLRQMMMDWCDLHTILRLPTGIFYAQGVKTNVIFLTRGKTETGNTKATWIYDL
FT                   RAQMPKFGKTTPLTEAHFEGFEKAFGTSPYGKERVKDEGEVGRWREFRREEIAARGDNL
FT                   DIAWLREADDEAEDGLTEPEDIAAAILGHLQAATLEIEALMAELGDELSEAAE"
FT   gene            148697..150187
FT                   /locus_tag="NGR_c01350"
FT   CDS_pept        148697..150187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01350"
FT                   /product="putative restriction endonuclease type I, S
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01350"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23938"
FT                   /db_xref="GOA:C3MFA1"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFA1"
FT                   /protein_id="ACP23938.1"
FT                   /translation="MSELPRGWCVTTIQEIADVGTGATPKRGTRAFYESGTIPWITSGA
FT                   VSQRQITYADEFITEAAIRSTNCKVFPTGTILVAMYGEGKTRGSVARLAIDAATNQALA
FT                   AIVLPNDDIVSSEFLMNFLTSQYSQLRGLAAGGVQPNLNLQLIRSTSFPLPPLAEQKRI
FT                   VAKLDALSAKSARARTELARIETLVYRYKQAVLGKAFSGELTVDFRLSRRHLQSEAKAG
FT                   SIHGEEGVERKLKVRGTTDVMKGIQLSPLPESWNWVKNHRLAQNRANAICAGPFGTIFK
FT                   AKDFRDKGIPIIFLRHVAAGEYRTHKPGFMDKKVWQELHQPYSVFGGELLVTKLGDPPG
FT                   VACIFPAGVGTAMVTPDVMKMSVDENASVPKFLMFYFNSPIAKNIIHQLAFGLTRLRVD
FT                   LAMFKTFPVPHPSLEEQLEIVRRIESAFAKIDRLAAEAKRALDLVGKLDEAILAKAFRG
FT                   ELVPQDENDEPAENLLERIRAERAAAPKAKRGRGNAKG"
FT   gene            150191..151438
FT                   /locus_tag="NGR_c01360"
FT   CDS_pept        150191..151438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01360"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23939"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFA2"
FT                   /protein_id="ACP23939.1"
FT                   /translation="MSFLREGPITLIARLVRSEALTNDDLVLQKANRVAFEFDAIDARM
FT                   SADEALATIADRADRSRLAVLKILTTAEKFQYLADIGDVRDGQWYRINLLPRGKKPGPF
FT                   AWASSLGDAGYEEIVPFVLDEIRYLFSEVDSPLSPVGAAVGNERALAQAIAEACKFPER
FT                   AIGKSRAARNLLSGANSPHKIVVRDVGQASFCSAIDQHGNELFHLDAGWPISYNKKTAA
FT                   SKPRLKVSDVPVILSHWDWDHLHGYHAIAGLAGGIWIVPVQRLGPGAKLVAEKLATNNR
FT                   LLGVSSANVSAGPLRLGRCKGKAGNLNQTGLCVQTTLQSGKTVLFMGDADYDLVRPRLS
FT                   TLPDFIVATHHGAKFRGSVVSPRGGSGRCVVSVGKGNGYGHPSAAAVMCHSGAGWSMSF
FT                   TCERNGIPRGSRHLGP"
FT   gene            151961..154363
FT                   /locus_tag="NGR_c01370"
FT   CDS_pept        151961..154363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01370"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23940"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFA3"
FT                   /protein_id="ACP23940.1"
FT                   /translation="MTPEEIFEDALVPNTRSVLVLGSFERRVTVYSQQVRALNLVDALL
FT                   SQNVVRDDGKIAIIGGGAAGVTAAVALSKAAPNLKALDLFEARADILQLQKNSTRYLHP
FT                   HFYDWPSIGSDEEDAGLPIMNWTAGPAGDVVRALWNQFDEACRTTRLSFYPNSTVTSLK
FT                   PSSISTVRVVTTGTAISRIYDVVILAIGFGLEAFLDGDTDSYWKPSALAGAMLVQMQEP
FT                   SIFISGNGDGGLVDFQMAAFNALDHRAICQLITNLDLGDALTELRTIEVEAWAPGANVN
FT                   LMDAYRMRVKPLIPAPAWATVVEALRNNVRIRLHTNEAQLLRKTTALHNRLATFLIIEA
FT                   DRDIERNAITVTTGVGFTDGVVPATGPISLDGEAPFTPYRRFLRLGPDSAPNLAPFDAL
FT                   LATYPGRLLPKASATRPESPTLTASARARFARFAPAAAPAQLPEQAAVGPRILRIVLQR
FT                   QGSNITWSGDLAPTDIDTLWRGNDGLSVYVDVAAADSDGLIAALARLGCHAASFHLYAR
FT                   DAQGWRTSMTSLCASRSLPGPDMGTRCIVNDWEDPPAVAQRATSPIADLTRIVSDRLDL
FT                   ETLSQLHGALYDVLGPPNVEIGWLIEARLKGQLWARWLNWHPVLQAESATRRRFMLLLV
FT                   TEQDHDNITPELLVRVGPRSLRPFLTKPTIFGLTFAVCSEHAVSPIAVAPGNMAGGGLT
FT                   GHACGVGWIQGRDLSAGFAAAQAWTTGVVLLAQLREAFRLAERDVRFDHAPGDQAKVGD
FT                   VLLDQEPLVIPADELFVIALEAGEQSMQQHLRSVIQWRATTNRASLE"
FT   gene            155006..158062
FT                   /locus_tag="NGR_c01380"
FT   CDS_pept        155006..158062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01380"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFA4"
FT                   /protein_id="ACP23941.1"
FT                   /translation="MSEIFLRSVELSNFRVYGDSYVFELPAEPGVTLITGANGLGKTSF
FT                   FDGVEWALTGQVGRFSDIRTDSRRREADPLTRLGAPENSHRVALAFTDGEPIDRGCGFL
FT                   PTEHEVAALLKQERWPAISNLHGYLSITHFLGQASTRRFSLREPKAQWEALKGPAGVDR
FT                   INSLRERVSGQGARQAFTRAIRDRTLRLEKASEALQSWLSLIEERDRLARLSSSERSFP
FT                   PQQVLEECERILAQLAPLLPAAQHEIAGRTEEPEAVLQRLGSLIGEVDEYNRAEEAKLK
FT                   ALEAIVAAYERSIAETAAKSALVKEMGARRSQLVDDLARAEATLNHAATAHGRSRQLSA
FT                   QLMARSATLARVEAAVAQLQSASSAIAETERQLDLSKAEEGRAQRRRGDVQSEMDNAKA
FT                   LRTERSRASTQLSQAQKRAQISTALSQTRSEIARLTSLTSARDSEQLTARRSEIVNAQS
FT                   LVKVEIDRLTTELRRHDERGRLLAEAIASIAHQLSHEDETCPICDSHFPPGRLKELADA
FT                   QARAGTAPASVLAANLSHARSEQEALMRRQSEVDRALTELGQLSASLVVLQEQEAHLLQ
FT                   ALVEAGGAVDVHYDGSGIDAARMVLASLDERIENGPSEVALDSLLAEVQAAMDAERARQ
FT                   GNLDRLRLNAISDAEAARSFLSQHPDLWAPDHGLLISLGEQLTAIRAESALIGEKVQND
FT                   QTNVEAARLRRDAIMEAIATEDASLSTSNRELDREAELRRDLLRQWNDAGQTGDPDSAR
FT                   VAQVSSRVAERSIRIGPIALAHAELIDSLRVWRNDQQLQDRERSIAATLANFGLSTIPQ
FT                   VTERFTRDIAVIQDELDLAQKARARMDDVGQKMQQRAEEFADEVLKPLNDTIQRFALPL
FT                   MTWTDASIIYRAEHHATRSELKPAIVRTDSDGKVTQLEMNPNLFFSEGQLSALSVSALL
FT                   AASTTFSWSRWRGLLLDDPLQHNDVIHASAFMDLIRQMVRELGYQVVLSTHDSTEAEFL
FT                   VRKCKSAGIPFAIHELVPRGEEGLISEVA"
FT   gene            complement(158332..158407)
FT                   /gene="trnT1"
FT                   /locus_tag="NGR_c01390"
FT                   /note="tRNA-Thr1"
FT   tRNA            complement(158332..158407)
FT                   /gene="trnT1"
FT                   /locus_tag="NGR_c01390"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACG"
FT   gene            complement(158482..159492)
FT                   /locus_tag="NGR_c01400"
FT   CDS_pept        complement(158482..159492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01400"
FT                   /product="putative 2-nitropropane dioxygenase-like
FT                   dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01400"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23942"
FT                   /db_xref="GOA:C3MFA5"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFA5"
FT                   /protein_id="ACP23942.1"
FT                   /translation="MPLPQILSGTTRLPVVGAPLFIVSHPRLTIAQCKAGVVGAFPSLN
FT                   ARPQAQLDEWLAEITEALADHDRKHPDRPAAPFAVNQIVHKSNTRLEQDLMLCVKYKVP
FT                   IVISSLGAVPEVNAAIHSYGGIVLHDVINNRHANSAIRKGADGLIAVAAGAGGHAGTLS
FT                   PFALIQEIRAWFDGPLLLSGAIATGDAILAAQAMGADMAYIGSPFIATHEARASDAYKE
FT                   MIVDSNAADIVYSNYFTGIHGNYLKASIRAAGMDPDGLPEADPSKMDFGAAADGAKAWK
FT                   DIWGCGQGIGAIREVSTVAHLVDRWESEYDAARARLGLALPSGLNAPKEFSTSRN"
FT   gene            159776..160948
FT                   /locus_tag="NGR_c01410"
FT   CDS_pept        159776..160948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01410"
FT                   /product="possible BirS-like protein incolved in biotin
FT                   regulatory network"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01410"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23943"
FT                   /db_xref="GOA:C3MFA6"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFA6"
FT                   /protein_id="ACP23943.1"
FT                   /translation="MSGLETAIRNALERSERSNAEVRARIYQSARQALENGLKKQEIED
FT                   PDIIAKQRHRLEAVIHAIETEERAALKARVASPVVSLAEVKAKGDAAGSAPAGAAAAAR
FT                   QEPGFQAEARAASTADGGLGALGALRPERDGPMAAAQPVTDGEKTVGAARSGSIAPDLG
FT                   VADKRPRKRRRGRLLSFFMVVATLAAAVGAGVWWVETNDLLKSPAERDTNVANPPAVVE
FT                   SEDFPGAAGLPTLGAQEGFSGDWIEVFTSADVSAVKPGTRASAEPFDDDGGERIRLTSA
FT                   AGAKEGEVAIDIPADVLAKLSGKSSTLALSVQALPGKTTEFSVECDFAALGACGRHRFT
FT                   AHDERVDMLFKMSFEDGRAPGSSGRLLINSDVSGAGNSLDLFAIRVLPGQ"
FT   gene            complement(161207..162109)
FT                   /locus_tag="NGR_c01420"
FT   CDS_pept        complement(161207..162109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01420"
FT                   /product="conserved hypothetical protein contains a
FT                   predicted polyphosphate kinase 2 domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01420"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23944"
FT                   /db_xref="GOA:C3MFA7"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFA7"
FT                   /protein_id="ACP23944.1"
FT                   /translation="MALEQSPTGGAPGSRAVELAIGGKTRVFDIDNPELPKWIDDDAFS
FT                   SDDYPYEKKLSEEEYEETLTKLQIELVKVQFWMQATGKRVMAVFEGRDAAGKGGAIHAT
FT                   MAYMNPRSARVVALTKPTETERGQWYFQRYVSTFPTAGEFVLFDRSWYNRAGVEPVMGF
FT                   CTPEQYEHFLKETPRFEKMIVNENIQLFKFWLNIGREMQLKRFHDRRHDPLKIWKLSPM
FT                   DIAALPKWNDYTEKRDRMLKETHTDHAPWTVIRGNDKRRARINLIRHMLTKLDYDGKDK
FT                   AAIGKVDDKIVGAGPGFLR"
FT   gene            162355..163599
FT                   /gene="phoR"
FT                   /locus_tag="NGR_c01430"
FT   CDS_pept        162355..163599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="NGR_c01430"
FT                   /product="two component sensor histidine kinase protein,
FT                   phosphate regulon sensor PhoR"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01430"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23945"
FT                   /db_xref="GOA:C3MFA8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFA8"
FT                   /protein_id="ACP23945.1"
FT                   /translation="MENEGAKVFWQGLKPKLKAERWILGLSIVLAVLAALAGIHVLAVF
FT                   AFWLVLAAALLKRSAPSAEPLPEAAPRIVEARTDALVPALNALDMPVLVIGADETVLFQ
FT                   NTAAEKAFGTIPPESYLSARVRSPGILDMVRETIATGKVNQIEHSERLPSDAVYVVRVA
FT                   PADIGGETLGGRVFLLTYRDISQTRRIDRMRSDFVANASHELRTPLASLRGFIETLAGP
FT                   ARNDLKAQEKFFGIMHEQVTRMSRLVDDLLSLSRLELKSHIAPEDAVDLVPLLGHVRDS
FT                   LQPLASDLDVTISLEVPEEPVFVQGDRDELIEVFENLIENACKYGQEGKKVDVRLTGSG
FT                   GQAEVTVTDHGPGIPAEHVPRITERFYRVNVEASRSKKGTGLGLAIVKHILTRHRARLL
FT                   IHSEVGKGTVFTVRF"
FT   gene            163793..164827
FT                   /locus_tag="NGR_c01440"
FT   CDS_pept        163793..164827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01440"
FT                   /product="predicted phosphate ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01440"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23946"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFA9"
FT                   /protein_id="ACP23946.1"
FT                   /translation="MKVLKLTVAALVASAAFAGAAVARDQIQVAGSSTVLPYAKIVAET
FT                   FGETFPDFKTPVVESGGSSAGLKEFCKGVGEDTIDIANSSRKIKDSEVEACKAAGVTEI
FT                   QEVKIGYDGIVFATDAGNADLALKPEQLYKALAAEVVVDGKLVANPYKKWSEIDASLPD
FT                   AEIAAYIPGEKHGTREVFEEKILAHGCKDAGAVDVIKAAISDEKAAAKKCVAVRKDGLA
FT                   VDIDGDYTETLARIASNKSGIGVFGLSFYENNADKLKVATVSGIVPSTETIASGEYPVS
FT                   RPLFFYVKKAHLGVVPGLKEYVEFFVDDQMIGPDGPLAEYGLVAAPDAEREEIRKTFEA
FT                   GNLL"
FT   gene            164922..166406
FT                   /locus_tag="NGR_c01450"
FT   CDS_pept        164922..166406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01450"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01450"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23947"
FT                   /db_xref="GOA:C3MFB0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR022182"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFB0"
FT                   /protein_id="ACP23947.1"
FT                   /translation="MSTTLLLLTILLIGLVAYFAGRARSLALSGSKLATLHSLPGYHGS
FT                   YVAIWAVLPAALVLAAWLLASPLYIDSSVRSALPETVQNQGAATVQLALSQVKAVATGL
FT                   GRLDATEIEAVKTGSANLRETLAAKGVALAGEGEPFMVEAAEQFNAMRGHSRWLMSAVV
FT                   LLVAVAGGLYAIRNVTTRFRARNQVERVMLGSLVVASSIAILTTIGIIGSMLSEAGRFF
FT                   SMVSPAEFFFGTVWDPRFAAAGSEGSSGQFGLLPLLGGTLYIAFVAMAFAVPIGLFAAI
FT                   YMAEYASPRLRSIAKPLLEVLAGIPTIVYGFFALVTVGPFLRDISTQLNGLLTGNYQNF
FT                   IQAQSVLTAGIVMGIMLIPFVSSLSDDIITQVPRALRDGSLGLGATRSETVKRVILPAA
FT                   LPGIVGALLLTASRAVGETMIVVLAAGVAARMQINPFEPMTTVTVKIVHQLTGDLEFTS
FT                   PQTLVAFALGITLFVITLGLNIYALYIVRKYREQYE"
FT   gene            166403..167725
FT                   /locus_tag="NGR_c01460"
FT   CDS_pept        166403..167725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01460"
FT                   /product="phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01460"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23948"
FT                   /db_xref="GOA:C3MFB1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR024573"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFB1"
FT                   /protein_id="ACP23948.1"
FT                   /translation="MTDVASPMVRVSTRPAESRRDIGIKRRYAAERRFRAYGISAIAIG
FT                   LFFLAVLLWSVASKGYTAFQQTTITLPIEFSEKVIDPKNERATDPKQLMTANYPVLVRD
FT                   ALVKQLGIDPKKRPLVKQATDMVSDSVRTQLRDIVTGDPSVIGKTIPVTLLADANIDSA
FT                   FKGQIDLSVEESKRKVKDQQVTWMNELAEAGVLKKSFNTGIFSFGASSRPEAAGVGVAL
FT                   VGSAYMMLIVLVLSLPIGVAASIYLEEFAPKNRLTDLIEVNINNLAAVPSIVYGLLGLA
FT                   VFVNFAGMPRSAALVGGFVLTLMTLPTIIIATRAALKAVPPSIRSAALGLGASKMQTIF
FT                   HHVLPLAMPGILTGTIIGLAHALGETAPLLLIGMVAFVVDYPGSPLEPSTALPVQIYMW
FT                   ANEAERAFVERTSGAIIILLIFLIIMNLGAILLRRRFERRW"
FT   gene            167738..168553
FT                   /locus_tag="NGR_c01470"
FT   CDS_pept        167738..168553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01470"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01470"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23949"
FT                   /db_xref="GOA:C3MFB2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFB2"
FT                   /protein_id="ACP23949.1"
FT                   /translation="MNIMSEAAVEKALDQKMNTVPLKMIGKDVSVYYGEKRALFDVNLN
FT                   IRENTVTALIGPSGCGKSTFLRTLNRMNDTIENCRVTGRITLDEDDIYDPSIDVVELRA
FT                   RVGMVFQKPNPFPKSIYENVSYGPRIHGLARTKADFDEIVETSLQKAGLWNEVKDRLQE
FT                   PGTGLSGGQQQRLCIARAVAVSPEVILMDEPCSALDPIATAKVEELIHELRANFTIVIV
FT                   THSMQQAARVSQRTAMFHLGNLVEENDTDKMFTNPDDQRTQDYIMGRFG"
FT   gene            168597..169313
FT                   /gene="phoU"
FT                   /locus_tag="NGR_c01480"
FT   CDS_pept        168597..169313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="NGR_c01480"
FT                   /product="phosphate transport system protein PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01480"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23950"
FT                   /db_xref="GOA:C3MFB3"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFB3"
FT                   /protein_id="ACP23950.1"
FT                   /translation="MMSHPHITTAFDEELKYLTRRISEMGGQAEQMVADSVRALVNSDL
FT                   ALAQKVISDDAILDDAERQIGEKAIVTIAKRQPMAADLREIMGSIRIAADLERVGDLGK
FT                   NTAKRVIAVAGSGIPRKLARGLEHLAELALIQLKEVLDVYASRSPEKANSIRERDEEID
FT                   AIYTSLFRELLTYMMEDPRNITPCTHLLFCAKNIERIGDHATNIAETIYYMATGAQPQG
FT                   ERPKDDMTSTLGSVTD"
FT   gene            169361..170044
FT                   /gene="phoB"
FT                   /locus_tag="NGR_c01490"
FT   CDS_pept        169361..170044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="NGR_c01490"
FT                   /product="phosphate regulon transcriptional regulatory
FT                   protein PhoB"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01490"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23951"
FT                   /db_xref="GOA:C3MFB4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFB4"
FT                   /protein_id="ACP23951.1"
FT                   /translation="MLPKIAVVEDEEALSVLLRYNLEAEGFEVDTILRGDEAEIRLQER
FT                   LPDLLILDWMLPGVSGIELCRRLRQRPETERLPIIMLTARGEESERVRGLATGADDYVV
FT                   KPFSTPELMARVKAMLRRAKPEVLSTVLRCGDIELDRETHRVHRRSREVRLGPTEFRLL
FT                   EFLMSSPGRVFSRSQLLDGVWGHDIYVDERTVDVHVGRLRKALNFSNMPDVIRTVRGAG
FT                   YSLES"
FT   gene            complement(170132..170650)
FT                   /locus_tag="NGR_c01500"
FT   CDS_pept        complement(170132..170650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01500"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23952"
FT                   /db_xref="InterPro:IPR011681"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFB5"
FT                   /protein_id="ACP23952.1"
FT                   /translation="MNWTDERVEKLKKLWSEGLSASQIAAQLGGVSRNAVIGKVHRLSL
FT                   PGRAKAGGTTAAARPKRATSAPRAPNYAARAVTRTVTRTAGATVLKEEVAVDLVAEQDL
FT                   VLDTNIVVPMSRRLELTQLTERTCKWPIGDPLKEEFHFCGNDSPESSPYCSYHARLAYQ
FT                   PSAERRRMR"
FT   gene            170968..172263
FT                   /gene="argD"
FT                   /locus_tag="NGR_c01510"
FT   CDS_pept        170968..172263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="NGR_c01510"
FT                   /product="acetylornithine aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /note="ACOAT"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01510"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23953"
FT                   /db_xref="GOA:C3MFB6"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFB6"
FT                   /protein_id="ACP23953.1"
FT                   /translation="MGIVPAPPQGGIFDFYRAESPVAMPTTKETLTMAATTPLYDTYLR
FT                   APLRFERGEGVWLIAEDGTRYLDFAAGVAVNSLGHAHPHLVEALKAQAEKLWHVSNLYD
FT                   VPGQESLARRLTAVTFADRVFFTNSGAEALECAIKTARRYHFAKGHPERFHVITFEGAF
FT                   HGRTIATIAAGGQQKYIEGFGPKAPGFYQVPFGDIAAVKNAINDETAAILIEPIQGEGG
FT                   IRLASKEFMQELRALCDEYGLLLILDEVQCGVGRTGKLFAHEWSGITPDIMAVAKGIGG
FT                   GFPLGACLATEAAAAGMVAGTHGSTYGGNPLAMAVGNAVLDVVLAEGFLENVRDVALVF
FT                   RQGLASLKDRFPDVIEEIRGDGLMLGIKAKVPCADVLKAIRAEKLLAVPAGENVLRLLP
FT                   PLITTAAEAREGLARLERAAEAVRAASGTAAA"
FT   gene            172333..173250
FT                   /gene="argF"
FT                   /locus_tag="NGR_c01520"
FT   CDS_pept        172333..173250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="NGR_c01520"
FT                   /product="ornithine carbamoyltransferase"
FT                   /EC_number="2.1.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01520"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23954"
FT                   /db_xref="GOA:C3MFB7"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFB7"
FT                   /protein_id="ACP23954.1"
FT                   /translation="MTATRHFLDLSAMTGADLRTIIDDARVRKTATKAGTAEKPLAGKM
FT                   LAMIFEKPSTRTRVSFDVGMRQLGGETLFLSGTEMQLGRAETIGDTAKVLSRYVDAIMI
FT                   RTTDHRRLLELAEHATVPVINGLTDDTHPCQIMADIMTFEEHRGPVQGKTIAWTGDGNN
FT                   VLHSLIEGSARFGYRMNMAVPLGSEPQDKFLNWARNNGGEILLCHEAEQAVAGAHCVVT
FT                   DTWVSMNQEHRARGHNVFQPYQVNAALMKHAVPEAVFMHCLPAHRGEEVTDEVIDGPQS
FT                   VVFDAAENRLHAQKSILAWCLGAV"
FT   gene            173663..174658
FT                   /gene="hslO"
FT                   /locus_tag="NGR_c01530"
FT   CDS_pept        173663..174658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="NGR_c01530"
FT                   /product="Hsp33 protein"
FT                   /note="heat shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01530"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23955"
FT                   /db_xref="GOA:C3MFB8"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFB8"
FT                   /protein_id="ACP23955.1"
FT                   /translation="MTETAPGLGEFDFAGDDHVVPFQVEGLDVRGRAVQLGPMLDAILE
FT                   RHSYPLPVARLVAETVVLAVLLGTSLKFEGKLIVQTQGDGPVDLVVADFSTPDRVRAYA
FT                   RYDEEALAAAEKGGRTQPHELLGNGILAFTIDQGVHTQRYQGIVALDGATLEEIAAVYF
FT                   RQSEQIPTKVRLAVAELLDRDENGKPRHRWRAGGMVAQFLPEAPERMRQPDLPGGDGDD
FT                   GDSSLLFDEDDLWAEAKVMVETIDIDELTDPTVGTERLLYRLFHERGVRVYQPQAVYDR
FT                   CSCSRDKIREVLEGLSDEDIEHSIEDGQIKVTCEFCSTNYRFEASEVRSQ"
FT   gene            complement(174671..175063)
FT                   /gene="apaG"
FT                   /locus_tag="NGR_c01540"
FT   CDS_pept        complement(174671..175063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="NGR_c01540"
FT                   /product="ApaG protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01540"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23956"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MFB9"
FT                   /protein_id="ACP23956.1"
FT                   /translation="MYRALTRDIEVTVEPYYLEEQSDPDDSRYVWGYRIVISNHSEIAV
FT                   RLMTRYWHITDENGQVDEVSGPGVIGEQPLLNPGDTYEYSSGCPLDTPSGVMFGHYSME
FT                   AEDGETFNVAIPAFSLDSPGLVRTLN"
FT   gene            175175..175789
FT                   /locus_tag="NGR_c01550"
FT   CDS_pept        175175..175789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01550"
FT                   /product="predicted CDP-alcohol phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01550"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23957"
FT                   /db_xref="GOA:C3MFC0"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFC0"
FT                   /protein_id="ACP23957.1"
FT                   /translation="MLDGAVRRQLDPILNRLGAALAGRGVSADAITICGLCLGLAAAAL
FT                   IAWQEYVAGAVLILSSRLCDGLDGAVARASRKTDFGGFLDIVLDFAFYGAIPLAFITAD
FT                   PAMNGLAGGFLLFAFYVNGSSFLAFAVIAAKRALSTEIRGAKSIYFTTGLAEATETIAF
FT                   FLACCLFPGWFPALAAIFAAICLYTAVSRIVLARLTFRDGQ"
FT   gene            complement(175843..177027)
FT                   /gene="metZ"
FT                   /locus_tag="NGR_c01560"
FT   CDS_pept        complement(175843..177027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metZ"
FT                   /locus_tag="NGR_c01560"
FT                   /product="O-succinylhomoserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01560"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23958"
FT                   /db_xref="GOA:C3MFC1"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006234"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFC1"
FT                   /protein_id="ACP23958.1"
FT                   /translation="MSKTWRPATQLVHGGTIRSQYGETSEAIFLTQGFVYDSSEAAEAR
FT                   FKGETEGYIYARYGSPTNDMFEKRMCMLEGAEDARATASGMAAVSAAILCQVKAGDHIV
FT                   AARALFGSCRWVVETLAPKYGVECTLVDGRDLKNWEDAVRPNTKVFFLESPTNPTLEVI
FT                   DIAGVAKLANQIGAKVVVDNVFATPLFQKPLELGAHIVVYSATKHIDGQGRCLGGVVLS
FT                   DKQWIDENLHDYFRHTGPAMSPFNAWTLLKGIETLPLRVKQQTENARRVADFLAEQPQV
FT                   ARVIYPGRKDHPQAGIIAKQMSGGSTLVACELKGGKDAAFALQNALHIVRISNNLGDSK
FT                   SLITHPATTTHKNLSDEARTELGISAGTVRFSAGIEDSDDLIEDFAKALTSVRA"
FT   misc_binding    complement(177071..177149)
FT                   /bound_moiety="SAM"
FT                   /note="NGR_c01570; SAM riboswitch"
FT   gene            177225..178322
FT                   /gene="dcd"
FT                   /locus_tag="NGR_c01580"
FT   CDS_pept        177225..178322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="NGR_c01580"
FT                   /product="2'-deoxycytidine 5'-triphosphate deaminase
FT                   protein"
FT                   /EC_number="3.5.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01580"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23959"
FT                   /db_xref="GOA:C3MFC2"
FT                   /db_xref="InterPro:IPR010550"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFC2"
FT                   /protein_id="ACP23959.1"
FT                   /translation="MGRETGILADRAIAALFASGRLKSEKALDDDQIQPASLDLRLGSK
FT                   AFRVRASFMPGPAHLVADKLDRLKLHVIDLSAGAVLETGCVYIVPLMESLSLPEGMSAS
FT                   ANPKSSTGRLDIFTRVITDRAQEFDKIPAGYNGPLYLEISPRTFPIVVRRGSRLSQIRF
FT                   RVGHSVLSEQELLGLHESDVLVASERPNISGGGIALSIDLKGTGPDGLIGYRGKHHTSV
FT                   VDVDKKAEHAVFDFWEPLYSRGRDDLILDPDEFYILVSREAVHVPPLYAAEMTPFDPLV
FT                   GEFRVHYAGFFDPGFGHASAGGSGSRAVLEVRSHEVPFILEHGQIVGRLIYEHMLERPE
FT                   GLYGLDLGSNYQAQGLKLSKHFRAE"
FT   gene            178532..178606
FT                   /gene="trnG1"
FT                   /locus_tag="NGR_c01590"
FT                   /note="tRNA-Gly1"
FT   tRNA            178532..178606
FT                   /gene="trnG1"
FT                   /locus_tag="NGR_c01590"
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGG"
FT   gene            178722..179573
FT                   /locus_tag="NGR_c01600"
FT   CDS_pept        178722..179573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01600"
FT                   /product="predicted extracellular amino acid solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01600"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23960"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFC3"
FT                   /protein_id="ACP23960.1"
FT                   /translation="MTRVFFHRLFGMLAVTVALLASGAGAAPNDLPLLFDARERIAKPD
FT                   LTALARLRFLTTVDFPPFNFIDQSGKLSGFHVDLAREICRELEIESKCQIQAVTYPELM
FT                   PALEQGQGEAIVAGIAVTPELRRRFAFSRAFMQMPARFALNRKAAEGVKSPADLVGKPI
FT                   GAVAGTTHEAMLKAFFPQLEAKAYPDRDALLNALREGAVTAAFSDAMQLSFWVSGSVAA
FT                   GCCTLLDGAYFSERFLGEGLTIMNRTTEPALTQAIDHALLALSRSGRLEEIYLRYFPNG
FT                   IY"
FT   gene            complement(179598..180008)
FT                   /locus_tag="NGR_c01610"
FT   CDS_pept        complement(179598..180008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01610"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23961"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFC4"
FT                   /protein_id="ACP23961.1"
FT                   /translation="MSASFSQHEALVYVMVMMSAVDRSMSDDEFARIGGLVRFLPAFDG
FT                   FDEDRLVHIGRECAAQLAAPEGLDVTLEMVRESLPQRHYETAYALAVEIAAADQRIRTE
FT                   EIRLLQLLRDRLALDKLTCAAIERGALARFRR"
FT   gene            complement(180057..180866)
FT                   /locus_tag="NGR_c01620"
FT   CDS_pept        complement(180057..180866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01620"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23962"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFC5"
FT                   /protein_id="ACP23962.1"
FT                   /translation="MRPQVISIVGGLAALALYAAILLGGAATIRGRESAATPDFVLETP
FT                   DAAAIDEPAEEPVPAAEPPAEPAPPPAEAAAKTSRTPVRPVDPNLFAIPEEGVAKPLER
FT                   IAPRPPFSAPPEKKAVPLVLQRPVALAAGLVQNGDTTLQIKDIEPEKAEKVCEGAGKSW
FT                   PCGMVARTAFRNFLRGRALVCDQIDEKAEGSPAVSCKVGNMNVAEWLVTNGWATPLPGT
FT                   PLEAKAEDARNAKRGFYGDDPRDLRRRPAVIEEPAAGTDFGEPAPDL"
FT   gene            complement(180879..181532)
FT                   /locus_tag="NGR_c01630"
FT   CDS_pept        complement(180879..181532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01630"
FT                   /product="putative peptidase, S24 family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01630"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23963"
FT                   /db_xref="GOA:C3MFC6"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFC6"
FT                   /protein_id="ACP23963.1"
FT                   /translation="MLSHDSIWRAIDALAERHQLSPSGLARRAGLDPTSFNKSKRQSPD
FT                   GRDRWPSTESISKVLEATGATIDQFMALLQSGSGPSSRTGLPAAGIPLIGFAQAGAGGF
FT                   FDDGGFPVGQGWDEVDFPVAAQSKASVYALEVQGDSMLPLYRDGDVLIVDPGASVRRGD
FT                   RVVLKSCEGEVMAKILARQTSRGVELLSLNPDHPNRSFEMKDVEWIARIVWASQ"
FT   gene            complement(181691..182215)
FT                   /locus_tag="NGR_c01640"
FT   CDS_pept        complement(181691..182215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01640"
FT                   /product="putative transcriptional regulator protein, HxlR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01640"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23964"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFC7"
FT                   /protein_id="ACP23964.1"
FT                   /translation="MTDDHRSACPINLSLEVFGDKWSLLIIRDMIFGGKRHFRELLRSQ
FT                   EGISSNILADRLKTLLEIGMLTKRDDPSHKQKAIYSLTEMAIALVPIMAHLGAWGRRYL
FT                   PVSEELSIRAQLMEEGGPVLWERFMDELRAEHLGVSRVSEGPSVRQTLQAAYEEVIARK
FT                   ATEREPANAGS"
FT   gene            complement(182367..182945)
FT                   /locus_tag="NGR_c01650"
FT   CDS_pept        complement(182367..182945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01650"
FT                   /product="hypothetical protein, putative transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01650"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23965"
FT                   /db_xref="GOA:C3MFC8"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFC8"
FT                   /protein_id="ACP23965.1"
FT                   /translation="MQPLPFALAILLLLATPGPTNTLLWLSGAAAGMRRSLPLLAGELG
FT                   GYLTVIVPVTVLAAPLISAHPAVGLLLKLAAAGWILFMAHALWTMKAQGASDRPIAPGQ
FT                   VFVTTLLNPKALIIALVIMPQVGLQAMLPWLLGFAMLTLGAGSLWIAAGTLLARLPRPV
FT                   APRLPRRIAAVCLVAFSFGIAGSALASMI"
FT   gene            complement(183275..183637)
FT                   /locus_tag="NGR_c01660"
FT   CDS_pept        complement(183275..183637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01660"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23966"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFC9"
FT                   /protein_id="ACP23966.1"
FT                   /translation="MPTRCRFPPRSTVLGMRTGGTTMSKSNRITVENIIHPGKTTSVDA
FT                   DKYAAMKTALLAVIPVQAPGLTLAEVRERIFAHLPEERFPGGKGVSWWSKAVQLDLEAR
FT                   GEIVREKTRPIRLHRS"
FT   gene            complement(183977..186190)
FT                   /gene="fadB"
FT                   /locus_tag="NGR_c01670"
FT   CDS_pept        complement(183977..186190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadB"
FT                   /locus_tag="NGR_c01670"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01670"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23967"
FT                   /db_xref="GOA:C3MFR6"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFR6"
FT                   /protein_id="ACP23967.1"
FT                   /translation="MSYTNFKIETDADGIALVTWDMPDKSMNVFTEEVMDELDAIVDQT
FT                   TADAAVKGVVFTSGKSSFSGGADLSMIKSMFTLQAEERKKDPANAAQKLFNLVGRMTGL
FT                   FRKLETSGKPWVSAINGTCMGGAFELSLACHGRVASNSKSVKIALPEVKVGIFPGAGGT
FT                   QRVPRLTNTQDALQMMTTGSSLTAARAKAMGLVHEVVEPEKLVEAAKAMIKNGLKAVQP
FT                   WDEKGFKLPGGGVWTPASAQLWPAASGILRRETYGNYPGAIAILKCVYEGLQVPFDTGL
FT                   KIEQRYFTEILQTTEAFSMIRSLFVSMQELGKGARRPAGVPKTEFKTVGVVGAGFMGAS
FT                   IAYVTAAAGIPVTLIDRDMEASEKGKAHSEGLVKDAIGKGRLTKEEGEALLSRITPSAD
FT                   YGDLKDAGLVVEAVFEDRQVKKDVIEKVEAVIAPDAIFASNTSTLPITGLARNSKRPEQ
FT                   FIGVHFFSPVEKMMLTEVIVGKETGDKALATALDYVAAIKKTPIVVNDTRGFYVNRCVF
FT                   RYIHEAYDMLIEGVPPAMIENAAKMAGMPVGPLSLNDEVAIDLSQKILKATVADLGEKA
FT                   VDPRHMELVNKMVDELDRRGRKNGKGFYEYPAKPAKKYLWPGLKELYSQKPADKVDVEV
FT                   VKQRFLATIALEAARTIEEGIVTDPREADVGSILGFGFAPYTGGTLSYIDGMGIKAFVA
FT                   MCNKLAKAYGDHFEPTPLLKEMAEKGETFYGRFDPYGQAQKAA"
FT   gene            complement(186212..187420)
FT                   /gene="fadA"
FT                   /locus_tag="NGR_c01680"
FT   CDS_pept        complement(186212..187420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadA"
FT                   /locus_tag="NGR_c01680"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01680"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23968"
FT                   /db_xref="GOA:C3MFR7"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFR7"
FT                   /protein_id="ACP23968.1"
FT                   /translation="MTKVFVYDHVRTPRGRGKKDGSLHEVPSVRLAAKVLEAVRDRNGL
FT                   DTATVDDIVMGCVDPVMDAGSVIPKAAAFEAGYSTRAPGMQISRFCASGLDAVNFGAAK
FT                   IAQGADDIVIAGGVESMSRVGLGMSGGSWFMDPSVSLPAYFMPQGVSADLIATKYGFSR
FT                   DDVDAYAVESQKRAAHAWEKGYFENSVVPVKDQNGLTILDRDEHMRPGTDMQALASLNP
FT                   SFQMPGEMGGFEAVAIQAHPEIERINYVHHAGNSSGIVDGAAAVLLGSKAGGEAMGLKP
FT                   RARIRAFANIGSDPALMLTGPVDVTEKLLKRADMKLSDIDLFELNEAFAAVVLRFMQAF
FT                   DIPHDQINVNGGAIAMGHPLGATGAMILGTVLDELERRDLNTALVTLCIGAGMGTATII
FT                   ERV"
FT   gene            complement(187532..189328)
FT                   /locus_tag="NGR_c01690"
FT   CDS_pept        complement(187532..189328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01690"
FT                   /product="acyl-CoA dehydrogenase protein"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01690"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23969"
FT                   /db_xref="GOA:C3MFR8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFR8"
FT                   /protein_id="ACP23969.1"
FT                   /translation="MPIYKAPVDDTLFILNDVLGLERYHNLPGFADATPDMVAAILGEA
FT                   ARLAEEELFPINLSGDQEGCKRNDDGSVTTPAGFKQAFDLYREGGWLGLAAPEEFGGQG
FT                   LPYTLHTAVGEFLSAANMSLMMYPGLTQGAIAAILVHGSEEQKRAYLPKMVDGTWTGTM
FT                   NLTEPHCGTDLGLLRTKAIPNGDGSYRISGQKIFISAGEHDMAENIIHLVLARIEGAPE
FT                   GVKGISLFIVPKFKLNDDGEPGARNGVSCGAIEHKMGIHGNSTCVMNYDEATGYLIGAE
FT                   NKGLNAMFVMMNEARLAVGMQGLAIAEIAYQNAANYARERLQGRSLSGVKAPEQKADPI
FT                   IVHPDVRRSLMTIKAFNEAGRAFTLWTALKSDIAHRSDNEAERQAADDILGLMTPILKG
FT                   VLTDKGFDHTVVAQQLFGGHGYIEEHGMSQYVRDARIAMIYEGANGIQALDLVGRKLAI
FT                   NGGRAVMALFKEIGDFCEENRGDERLSAYTKALKKGLNDLQAATMWFMQNAMAKPDNAG
FT                   AGSTDYMHLFGLVVLGYMWAKIAKTAHDKLAAGETAQADYLKNKLITANFFMERILPET
FT                   ALRKARIETGADTLMALDAAAF"
FT   gene            189749..193432
FT                   /locus_tag="NGR_c01700"
FT   CDS_pept        189749..193432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01700"
FT                   /product="hypothetical protein contains peptidoglycan
FT                   binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01700"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23970"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFR9"
FT                   /protein_id="ACP23970.1"
FT                   /translation="MNGSRSNPQRTGSPSYGDRPSLDALNRTIEGLEARIEGLMSSVGR
FT                   EQRQPDRRAAPANNAVSEILDRQRALSGARERLPLRERISARQSDRPVPAPARLAEEPR
FT                   YQPTPPVPTQPPRPSAATDIAEALVGLRQDLKRDISDGFAREMHALRSEIRGIKAEASE
FT                   DRGYAADIRADLQRLADNINQLGRQAPSAQADALRVEFDDLRAMIDGLAREDSMRRMES
FT                   RWSGVEDRLNAFDQNRDDELVALAYRLDEIKSQIGTLSQVSAVDMLEDKLVVVARAIET
FT                   LGRQMEPDDRRFASQFAELDQRLDEISRAVAVGRNAASLDSAFVNRLENRLGDLSHQID
FT                   NLARPVDAGLGARIEALSARVEDLAGDRAAARLEERLDQLSALLERSQRNVAPELADYL
FT                   ADISRRIEALDQGSVNDVLAERLDYLARRIDELDGHGESPAPDMRFDRLEDRLADIAQR
FT                   LEETQAAPFDDREALRNLEAQIGNLSALVSRSHQEPAGAAPIEFESRMTALEDYLATSD
FT                   EYIIEAARQAAEAVMEAYARNGMPQTASGTDMAAISALAEDLRALEDISRSSEERTART
FT                   FEALHDTLVHIAEKLERLEEREPGAGVRIASPNAPAMPKAVEPEFAGAFNEADLARQGS
FT                   LQRLGTAVDADVDVTVASPVAADLSPSGAASQVAVPAAKAGLLAGLTRRFSAKRNETAP
FT                   AQARQMVEPTPSIDPSEMLAPEDANQLLEPGSGVPDVKKILERVRAGQMARGGQSADGG
FT                   EKADFIAAARRAAQMAVEEADSLKSAKDHKGPSAAGGAFARHRRPILMAVGAVLLAIMS
FT                   YPLVSTMLKDRDAESVQPAAAIERKAEAEIAPKAVGEEAAKPLAAAVAAKPAGLPKAAA
FT                   PVEKTGTPPIATKAAATGGDKPAAAVPAVEAGQAPLLQPVAEPAKSGPVSTFQPTSPGA
FT                   PTVANFAPVKANEIVLPEGFGPPALLTAAKGGDPLAYYEIGTRFTEGRGVKEDLVEAGK
FT                   WYQRAADAGVVPAAYRLANLYEKGAGVARDAAKAKALYQKAAEAGNASASHNLAVMLAS
FT                   GRDGAPDLAAAAKWFEKAADLGVRDSQFNLAVLYARGNGVAQSLEDSYKWFAIAARDGD
FT                   KDAGEKRDEIAKALKPEELASAKAKAEAWKVQPVDAGANTVDVPDAWIGPSTKTASVDM
FT                   TKAVRNIQAILNNNGFDAGAPDGHMGKKTIAAIKAFQKSIGHEPTGEVTDELVKELLKR
FT                   NS"
FT   gene            193822..194748
FT                   /locus_tag="NGR_c01710"
FT   CDS_pept        193822..194748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01710"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01710"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23971"
FT                   /db_xref="GOA:C3MFS0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS0"
FT                   /protein_id="ACP23971.1"
FT                   /translation="MTVYLPIAELSVNIFIILGMGAAVGFLSGMFGVGGGFLITPLLIF
FT                   YNIPPVVAVATGANQVVASSISGAITHFRRGTIDIKLGTVLLCGGLVGATLGVWLFSLL
FT                   RSIGQLDLVISLLYVVLLGSVGGLMLWESIGAMRKAARNQPTQLRRPGQHNWIHGLPLK
FT                   MRFKKSKIYLSVIPVATLGFSIGILTSIMGVGGGFIMVPAMIYLLRIPTSVVVGTSLFQ
FT                   IVFVSAYTVIVQASTNYTVDIVLAFVLMIAGVIGAQYGVRVGQRLRGEQLRALLALLVL
FT                   AVGIRLAIELIIPPKDIYSVVSAGFGF"
FT   gene            194748..195551
FT                   /locus_tag="NGR_c01720"
FT   CDS_pept        194748..195551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01720"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01720"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23972"
FT                   /db_xref="GOA:C3MFS1"
FT                   /db_xref="InterPro:IPR019088"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS1"
FT                   /protein_id="ACP23972.1"
FT                   /translation="MRALARLVLFAAALTVCGPVAAQSLEREVGDFTEKLEIGISTDEI
FT                   SITSDFRGADLTIFGAIDGFDADLLAQGKYNIIVVLEGPKDNATVRKKQRVFGIWVNTQ
FT                   SMTFELVPEAYSLSSTRDIATIAPPRDIANMGIGVDHMRLVPLGFIGDGSSLGEFRNAF
FT                   RRIREESGVYQRDPGGVQFISSSLFKASVRLPANVPNGIHVVRAYLFRDGLFVAAKALP
FT                   LRVVKTGLEQAITRAAHEQPLIYGFLAVTLAAITGWGASLLFRKE"
FT   gene            195720..195956
FT                   /locus_tag="NGR_c01730"
FT   CDS_pept        195720..195956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01730"
FT                   /product="putative transcriptional regulator protein, AsnC
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01730"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23973"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS2"
FT                   /protein_id="ACP23973.1"
FT                   /translation="MKPIFVQLQCAPGRTYDVADEIYRKEIVSEMYSTSGDYDLLLKIY
FT                   VEEGQDIGKFINDNIASVPGISRSLTTLTFNAF"
FT   gene            complement(195958..196689)
FT                   /locus_tag="NGR_c01740"
FT   CDS_pept        complement(195958..196689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01740"
FT                   /product="putative phosphoesterase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01740"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23974"
FT                   /db_xref="GOA:C3MFS3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024173"
FT                   /db_xref="InterPro:IPR026336"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS3"
FT                   /protein_id="ACP23974.1"
FT                   /translation="MTMHRLVHATSAIETSALFQARTTVNGVAAICDALGGLFLPDTRT
FT                   LVVSDLHLEKGSAFARRGMMLPPYDTLATLRILEAIVARYDPATVISLGDNFHDRRGSV
FT                   AMPDTFRQMITAMARGRDWIWINGNHDPDGASGLPGASMDELRHAGLVFRHEPSMADGL
FT                   GEIAGHMHPSATVRRRERSIRRACFATDGRRLLMPAFGVTTGGLDLRHRAMSGLFDRQQ
FT                   LVAHMLGRDRIYSVRFANLLG"
FT   gene            complement(196951..199599)
FT                   /locus_tag="NGR_c01750"
FT   CDS_pept        complement(196951..199599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01750"
FT                   /product="predicted ATP-dependent RNA/DNA helicase protein,
FT                   DEAD/DEAH box family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01750"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23975"
FT                   /db_xref="GOA:C3MFS4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS4"
FT                   /protein_id="ACP23975.1"
FT                   /translation="MDGLRPSPRINPERGNCAHTASGFSFVSFDLPLFPVDRIDSPLPE
FT                   SDALTLPAPFLRWFAEKGWRPRAHQLELLSRAEAGQSTLLIAPTGAGKTLAGFLPSLVD
FT                   LVRRGRIPPGSAFIGIHTLYISPLKALAVDIERNLMKPVNEMGLPVRIENRTGDTPQAK
FT                   RQRQKLSPPDLLLTTPEQLALLIADGEAERFFKDLRYVVLDELHSLVTSKRGHLLALGL
FT                   ARLRRLAPGLQTIGLSATVAAPMELQRWLVGQTPDEESYAGLITVSGGAKPEISILRAE
FT                   SHVPWAGHSARYAIPDIYAAIKAHGTTLLFVNTRSQAEMLFRELWTINDDNLPIALHHG
FT                   SLDVAQRRKVEAAMAENRLRAVVATSTLDLGIDWGDVDLVVHVGAPKGASRLAQRIGRA
FT                   NHRMDEPSRAILVPANRFEVMECQAALDANYVGAQDTPPVGKGALDVLAQHVLGMACAK
FT                   PFDPLALYDEITSAAPYADLSWETFERVVDLVATGGYALRTYERYARVRKTKEGLWRVS
FT                   NPMVAQQYRLNVGTIVESPMLNVRMVKRNARGSLGRGGMSLGKVEEYFLEMLSPADTFL
FT                   FSGKVLRFEGIRENECLVSQAFSFDPKVPSYAGGKFPLSTYLAAQVRKMLADPARRATL
FT                   PDQVRDWLALQGDASMLPREDELLVETFPRGSRHYMVTYAFEGRLAHQTLGMLLTRRLD
FT                   RAGLKPLGFVATDYSLGIWALDDMGAAFRAGAPSLAQLFDEDMLGDDLEAWLNESFLLK
FT                   RTFRTCAVIAGLIDQRHPGKEKTGRQVTVSADLIYDVLRMHEPDHILLEATRNDAASGL
FT                   LDIGRLGTMLKRIKGHITHRRLDRISPLAVPVMLEIGRESVHGEAQDFLLTEAADELIN
FT                   EAMGIGQAAGE"
FT   gene            complement(199603..200238)
FT                   /locus_tag="NGR_c01760"
FT   CDS_pept        complement(199603..200238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01760"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01760"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23976"
FT                   /db_xref="GOA:C3MFS5"
FT                   /db_xref="InterPro:IPR003740"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS5"
FT                   /protein_id="ACP23976.1"
FT                   /translation="MAQTSSVFGLWNTSPTRHTPIEDVQGVFSGSLVAALGLYFLASAG
FT                   LLTGSTAGVAFLLHYATGVNFSLAFFLLNLPFFYLSLKQLGAAFTIKTFIAIGVTSLLT
FT                   DAQSRLFEIEQIHPGWAALLGGLLLGYGVLALYRHRASLGGVGILGVYLQERFGIRAGL
FT                   VQLAIDMVVLGVAFAVTTPWVVLWSVLGAVVLNLFVAINHRADRYIAL"
FT   gene            complement(200343..201281)
FT                   /locus_tag="NGR_c01770"
FT   CDS_pept        complement(200343..201281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01770"
FT                   /product="hypothetical protein"
FT                   /note="partial similarity methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01770"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23977"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS6"
FT                   /protein_id="ACP23977.1"
FT                   /translation="MAAHQLSSGDLIADRRADYAKMLAESGDHQGAAELMAQALELVPN
FT                   WAAGWFRLADYEEKSGRKEAAVAALRTTLRLNSEDIFGASLKLALLGAGDAPEQPPSTY
FT                   VERLFDDYAERFDQALVEKLDYSVPEKLAALIDRATGAQKFRHVTDLGCGTGLFGERIR
FT                   GRADFLEGFDLSANMLAKAEGKAIYDRLGRADLSLSPDDCGLFGELAEARADLVSAADV
FT                   LMYLGSLESAFTIADRLLAPGGLFAFSVEDAADNVGFVLRPSLRYAHSQAHVASLCAAF
FT                   GLSTIAIERTVIRMDAGLPIAGILFLAGKSA"
FT   gene            201426..201692
FT                   /locus_tag="NGR_c01780"
FT   CDS_pept        201426..201692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01780"
FT                   /product="hypothetical protein, putative transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01780"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23978"
FT                   /db_xref="GOA:C3MFS7"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS7"
FT                   /protein_id="ACP23978.1"
FT                   /translation="MSDGVNKFLGDSPLRVLVKLVVVSILVGFVMTVFDWRPMDLLDGI
FT                   RDFVVDLWRSGFAALGRVGDYLLLGAAVVIPAFIILRLLSYRR"
FT   gene            201695..202198
FT                   /locus_tag="NGR_c01790"
FT   CDS_pept        201695..202198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01790"
FT                   /product="conserved hypothetical protein contains SCP-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01790"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23979"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS8"
FT                   /protein_id="ACP23979.1"
FT                   /translation="MQDQFFLPRRRLVLSAGAALSLGLVAGCSTTGLLTPDDGTGSDQT
FT                   DATLGYVNTLRKGKGLATLERDPAASVAAMHQAARMARAGKMKHNIGWRDDFADRMKGD
FT                   GVTLPAAENIAMGQDNAERAYEAWFNSPKHLENMLGRYRGLGVAVAQNTASGNRPFWAM
FT                   VLSG"
FT   gene            202247..203614
FT                   /gene="dinF"
FT                   /locus_tag="NGR_c01800"
FT   CDS_pept        202247..203614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinF"
FT                   /locus_tag="NGR_c01800"
FT                   /product="DNA-damage-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01800"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23980"
FT                   /db_xref="GOA:C3MFS9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS9"
FT                   /protein_id="ACP23980.1"
FT                   /translation="MTAMAGRERERLASEAGPFDVTNRLILSIALPMTLGFLTTPLLGL
FT                   VDTGVVGRLGRAEMLAGLAIGAVLFDLIFTTFNFLRASTTGLVAQAYGRGDRREQQAVF
FT                   WRSLVIALFCGVAIVLLSPLLLSLGLWLMAPEAEVAAVTRTYFLYRMLSGPAALANYAI
FT                   LGFVLGRGEGTLGLLLQTLINGINIVLAILLGLVLGWGVAGVAIATVTGEVAGAVAGFA
FT                   IVYSRFDRRDAPNWATIFAGDRLKALFGLNRDIMIRSFVLLAAFTLMTRIGSSLGPVTL
FT                   AANAVLMTIFLVAGYYLDGLANAAEQLTGRSIGAAYRPGFDRALRMTALWSLGLALLTT
FT                   VFFLAFGNGLVDLLTTAPEVRALAYEFMPWAAVTALTGAMAFLMDGVFIGATWSRDMRN
FT                   MMLAAFVVYGAALTVLVPAFGNHGLWAGLNLFLLLRGLFLVLLLPRRAAQTFRPAQ"
FT   gene            complement(203590..204678)
FT                   /gene="pyrD"
FT                   /locus_tag="NGR_c01810"
FT   CDS_pept        complement(203590..204678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="NGR_c01810"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.98.1"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01810"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23981"
FT                   /db_xref="GOA:C3MFT0"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MFT0"
FT                   /protein_id="ACP23981.1"
FT                   /translation="MTGPLERLARRGLFLLDPETAHGVSIKALKSGVVPSCAAPADTRL
FT                   EQVIAGLNFPNPLGMAAGYDKNAEVPEALLRLGFGFTEIGTVTPRPQAGNDKPRIFRLV
FT                   EDEAVINRLGFNNDGHGAALARLQACSRQALIGVNIGANKDSADRIADYVAGIRTFYAV
FT                   ARYFTANISSPNTPGLRDLQARESLAALLSAVLAARDEEAAKTGRRVPVFLKIAPDLTE
FT                   EGMDDIAAEVLAHNLDGLIVSNTTLARDGLRDQRQAKEAGGLSGRPLFEKSTAVLARMR
FT                   KRLGPDVPIIGVGGVSSAETAAEKIRAGADLVQLYSCMVYEGPGLPGRIVRGLSQLCDR
FT                   DKLASIREIRDSRLDYWAGRNV"
FT   gene            complement(204675..205043)
FT                   /locus_tag="NGR_c01820"
FT   CDS_pept        complement(204675..205043)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01820"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23982"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFT1"
FT                   /protein_id="ACP23982.1"
FT                   /translation="MTDERTKMNATIYKIVPALLWQEARRAGQFAGAPIDLADGFIHFS
FT                   THDQVAETAARHFEGQTDLLLVAVDADALGDKLVYEPSRGGALFPHLYAPLTLDAVRWE
FT                   KPLPLGADGKHIFPELAP"
FT   gene            205141..205572
FT                   /locus_tag="NGR_c01830"
FT   CDS_pept        205141..205572
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01830"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23983"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFT2"
FT                   /protein_id="ACP23983.1"
FT                   /translation="MKKVVAALAFGLALGGSHSAWAQEAAPGRFSMQKAETGFARLDTE
FT                   TGEVTLCQEKNGELVCRMAADERAAFERELDLLTKRVEALEKAVQGGATAVKPDLPTDE
FT                   EIDRTMSIMERMMRKFMDIVKELEGRDTTEEGGPVPDKT"
FT   gene            205679..206326
FT                   /locus_tag="NGR_c01840"
FT   CDS_pept        205679..206326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01840"
FT                   /product="predicted two-component transcriptional
FT                   regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01840"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23984"
FT                   /db_xref="GOA:C3MFT3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFT3"
FT                   /protein_id="ACP23984.1"
FT                   /translation="MPDMTIIIADDHPLFRGAMRQALSGMDGSPAVVEAGDFAAARKAA
FT                   ADNPDADLMLLDLTMPGVSGLSGLIALRAEFPSLPVMIVSAHDDPATIHRAIDLGAAGF
FT                   LSKSAGIEEIRDGIGKVIAGEIFVPAGYDQNQEYEPEVADLLHRLQTLTPQQSRVLSML
FT                   AEGLLNKQIAYELGVSEATIKAHVSAILLKLNVDSRTQAVIQLSKLGSVAAA"
FT   gene            complement(206552..210058)
FT                   /locus_tag="NGR_c01850"
FT   CDS_pept        complement(206552..210058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01850"
FT                   /product="predicted two-component sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01850"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23985"
FT                   /db_xref="GOA:C3MFT4"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFT4"
FT                   /protein_id="ACP23985.1"
FT                   /translation="MLSGSVILASAFAYLLLLFAVASYGDRRASRSKIASKGRPLVYAL
FT                   SLAIYCTSWTYFGGVGLAAEHGLEFTGIYIGPILMFTLGMPLIRRIVRLAKTEKLTSVA
FT                   DFVAARYGKNPAVAAIVALISLVGAIPYIALQLKAVSSSVAAMIDTSDYGIGAGENFID
FT                   LPLLVTLFLACFAIVFGTRHTDATEHQDGLILAIAMESVVKLVAMLTAGIYIVFVLFDG
FT                   PANLLAAAQQSPAVLSALEYQTPVARWILLIVLSSFGIIMLPRQFHVTVVENRTENELR
FT                   TAGILFPLYLIAINLFVLPIAIAGILTFSGSGDADLYLLALPLAGDVPFITLLTFIGGF
FT                   SAATAMVIVASVALSIMISNDIVMPVFLRQRLGTRGTLQESMAGTLLNIRRTAIFAVLL
FT                   LGYSYYRSADMSAGLASLGLLSFVAISQMAPALLGGLVWRQANARGAIAGMVSGFLVWA
FT                   YALFLPSLGGPDNSHVASTILSFLLPFTDLFSGPQSDPLVNASALSLLVNVFAYVLGSL
FT                   TRTPKPLERFQAGVFITRRSRTERAFRGRKTKVTVRDLKTTIARYMGDERMQRSFHTYE
FT                   QQSGRWLDENASADMALVHFSEQLLGSAIGSSSARLVFSLVLQRMDDPSSDTAWLLDQA
FT                   SEALQHNQDMLQTALSQMDQGIAVFDNASNLIIWNRRFRELLDLPEAAGQVGFPLADIV
FT                   AILARRGDIRKDEEKTLVANFLALDKPFLLELGNGTRIVEVRTNAMPDKGIVTTYTDIT
FT                   PRVAADMALKQANETLELRVAERTSELTRVNRELGEARAVAEDANIGKTRFFAAAGHDI
FT                   LQPLNAARLYSSSLVERLGDSDNKALVQNIDSSLESVEAILGAVLDISRLDTGAMKPRL
FT                   QAVPLNDLLRRIETDFAPMARAKDIAFTVMPTSLVVRSDPNLLRRVVQNLVSNAIKYTL
FT                   EGKVLVGVRQHGQTATIEVLDSGIGIPASKFRTVFKEFARLDEGARTASGLGLGLSIVD
FT                   RISRVLNHPVGLQSKPGKGTGFKVSVPLDTSATEPARPQPVAATKTSEALTGLAVVCID
FT                   NEPKILEGMALLLGGWGCAVTTVESVAACARMGPGNLPARPDAIVADYHLDDGTGIEAI
FT                   AAIRALWQESIPALMVTADRTPEVRGAAERDGVSLQHKPVRPAALRAWLTQLAAAGRTA
FT                   AE"
FT   gene            210297..210725
FT                   /locus_tag="NGR_c01860"
FT   CDS_pept        210297..210725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01860"
FT                   /product="large-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01860"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23986"
FT                   /db_xref="GOA:C3MFT5"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MFT5"
FT                   /protein_id="ACP23986.1"
FT                   /translation="MLNEFKEFIARGNVMDLAVGVIIGAAFTKIVTSVVDDLVMPIVGA
FT                   ITGGGFDFSNYFLPLSANVTAPTLAAARQQGAVFAYGSFITVLINFMILAWIIFLLVKA
FT                   VNRIRASVEREKAPEPAAPPPEDVRLLSEIRDILKQRA"
FT   gene            211041..212207
FT                   /locus_tag="NGR_c01870"
FT   CDS_pept        211041..212207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01870"
FT                   /product="aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01870"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23987"
FT                   /db_xref="GOA:C3MFT6"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFT6"
FT                   /protein_id="ACP23987.1"
FT                   /translation="MTIMTSLSPRALSAPESGIVEVVNYARGRDGLIPLWVGEGDLPTP
FT                   DFISRAAAQGLMGGETFYTWQRGIPPLREALVRYYQRRFQKTLAPENFYVTGSGMQAIK
FT                   LSIEAIASPGDEIVLLTPAWPNFAAAADLSGVRPVSVPLRFENGKWQLDLDRLEAAIGK
FT                   KTRALFINTPSNPTGWTATQDDLKAILSLARKHGLWIIADEIYALYYYLGGRAPSFLDI
FT                   MAEDDRILFVNSFSKNWAMTGWRVGWIVAPPAVGQVLENLIQYSTSGVAQFMQRGAVVA
FT                   LDEGDGFVDDNVAKARRNRDMLCDALIATNRVETLKPDGALYAFLKIDGVTDARRASMD
FT                   IVDETGVGLAPGTAFGEGGSLFMRACFLRDPAQIAEAADRLRTYILGR"
FT   gene            212379..213413
FT                   /gene="galE"
FT                   /locus_tag="NGR_c01880"
FT   CDS_pept        212379..213413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="NGR_c01880"
FT                   /product="UDP-glucose 4-epimerase protein"
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01880"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23988"
FT                   /db_xref="GOA:C3MFT7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFT7"
FT                   /protein_id="ACP23988.1"
FT                   /translation="MAILVTGGAGYIGSHMVWSLLDAGETVVVLDSLTTGFRWAVAPEA
FT                   RFYFGDVGDRAVLARIFAENEIDAVVHFAGSAVVPESVAKPLAYYENNTAKTRMLIAAT
FT                   IEAGVRRFVFSSTAAVYGTQDTPEPVKETAWLRPESPYGRSKLMSEIMLQDAAAAHDFS
FT                   YVALRYFNVAGADPLGRAGQSTFGATHLIKVACEAALGKRRKVDVFGTDYPTADGTGIR
FT                   DYIHVSDLVAAHRNALDYLRRGGEPLVTNCGYGEGFSVLQVLDTVRQVSGCDFRVDYAP
FT                   RRPGDAAQVVADPTVARLKLDWVPTHASLEHIVQSAFDWEGYLSRKNSFDAGRSEDGRL
FT                   VANG"
FT   gene            complement(213427..213732)
FT                   /locus_tag="NGR_c01890"
FT   CDS_pept        complement(213427..213732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01890"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23989"
FT                   /db_xref="GOA:C3MFT8"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR008241"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFT8"
FT                   /protein_id="ACP23989.1"
FT                   /translation="MPKTPAECTTMADVRAEIDRLDRALMALFAERWGYIDRAAEIKRP
FT                   LNLKADIPARVAEVRENARRHAVAFGLEPDFYEELWAQLIDHAIAHERTLLGEDQE"
FT   gene            complement(214304..215308)
FT                   /locus_tag="NGR_c01900"
FT   CDS_pept        complement(214304..215308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01900"
FT                   /product="cytochrome bd ubiquinol oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01900"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23990"
FT                   /db_xref="GOA:C3MFT9"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFT9"
FT                   /protein_id="ACP23990.1"
FT                   /translation="MALDLPFIWAALIAFAVLAYVVLDGFDLGVGILFPLFPEKHDRDV
FT                   MMNSVAPVWDGNETWLVLGGGGLMAVFPLAYATIMPALYAPIIAMLIGLIFRGVAFEYR
FT                   WRTKRAEYLWNWAFAGGSTLAAFAQGLALGALVQGIPIEDRAYAGGWWDWLTPFSIVTG
FT                   VAIVVGYALLGATWLIMKTRGDLAERARSIALKCAFGTIAAMGIVSLWTPFLERVYLQR
FT                   WFGWPTAIFSVIVPLLVLGCLYLLLKGIQERRDAQPFLAALGLFVLGYIGIGISFYPYM
FT                   VPPSLTIWDAAAPNESLAFLLVGALVLVPIILAYTAYAYWVFRGKVDPEEGYH"
FT   gene            complement(215298..216713)
FT                   /locus_tag="NGR_c01910"
FT   CDS_pept        complement(215298..216713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01910"
FT                   /product="cytochrome bd ubiquinol oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01910"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23991"
FT                   /db_xref="GOA:C3MFU0"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFU0"
FT                   /protein_id="ACP23991.1"
FT                   /translation="MFEAFDATLLARIQFAFTVSFHIIFPAFSIGLASYLAVLEALWLW
FT                   KKDAVYLELFNFWKTIFAVAFGMGVVSGIVMSYQFGTNWSVFSDKAGPIIGPLMGYEVL
FT                   TAFFLEAGFLGIMLFGLNRVGPRLHFLATVMVAIGTLISATWILSANSWMQTPAGFATN
FT                   EAGQFIPVDWWAIIFNPSFPYRLVHMVLAAYLTTALVVGACGAWHLLHNTAPRRARTMF
FT                   SMAMWMAAIVAPIQIFAGDQHGLNTLEHQPAKVMAMEGHYHSHPDGAPLVLFGIPNSAE
FT                   KRIDYAIEVPKLGSLILKHDLDAPLAGLDTIPDELHPPVAVVFWSFRVMVGMGLAMLGI
FT                   GLWSLWCRYRGTLDGDIWLHRAAVLMGPAGFVAVLAGWITTEVGRQPYTVYGHLLTANS
FT                   IAPIEAPAIGASLVAFIVVYFLVFGAGTFYILRLMARLPRDTMPELDEGPLRTAGVTPG
FT                   PATAKPHGGHHGS"
FT   gene            complement(216906..218075)
FT                   /locus_tag="NGR_c01920"
FT   CDS_pept        complement(216906..218075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01920"
FT                   /product="metal-dependent
FT                   amidase/aminoacylase/carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01920"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23992"
FT                   /db_xref="GOA:C3MFU1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFU1"
FT                   /protein_id="ACP23992.1"
FT                   /translation="MKLSAAISNALPELVAIRRDLHAHPELGLEERRTSAFIAGHLEAL
FT                   GYTVTTGLAKTGVVGTLKVGAGPRSIGIRADIDALPILEETGLDYASKTPGLMHACGHD
FT                   GHTAMLLGAARALAERRNFDGTIHLIFQPAEENFGGAKIMIDEGLFDKFPCDAVFALHN
FT                   EPNLPFGQFALREGPIGAAVDEARITVHGRGGHGAEPQETADPIVCGASIVMALQTIVS
FT                   RNIHPMDPTVVTVGAFHAGSASNIIPERAEIVVGIRSFDPAVRDALERRIRMIAEAQAA
FT                   SFGMRATVDYQRSYDATINHKSETDFVRDLAVRFAGADKVVDLARPYMGSEDFAYMLKE
FT                   RPGTYFFLGSRVTGEEKPLHHPGYNFNDDLLPIGAAFWTELAEAYLARA"
FT   gene            complement(218077..218901)
FT                   /locus_tag="NGR_c01930"
FT   CDS_pept        complement(218077..218901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01930"
FT                   /product="putative amino acid ABC transporter, inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01930"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23993"
FT                   /db_xref="GOA:C3MFU2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFU2"
FT                   /protein_id="ACP23993.1"
FT                   /translation="MTDETTHALALVPEDLPKAEAFLKPHRIVLMLVFAGLIVAIAVFM
FT                   RWDWLPRYLPRLGSGILVSLAMLFSTAILGFLLAVPLGLVQVTGPWFLKAPARLFCTVI
FT                   RGTPLLLQLWLLYYGLGSLFPQFPAIRHSLLWPYLREAWPYGVAALTLSFAAYEGEVMR
FT                   GAFAGVPQGELEAARAYGMGRWTTFRRIWLPRAVHRALPTLNGETVLQLKSTPLVATIT
FT                   VVDVYAVISKVRQETFLTYEPLLLLALIYLCLTGILVVAFRYFENRIPTRGA"
FT   gene            complement(218898..219623)
FT                   /locus_tag="NGR_c01940"
FT   CDS_pept        complement(218898..219623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01940"
FT                   /product="putative amino acid ABC transporter, inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01940"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23994"
FT                   /db_xref="GOA:C3MFU3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFU3"
FT                   /protein_id="ACP23994.1"
FT                   /translation="MAADSLINWSLLALAAPGWGGVLLQGFLHSIEIAIGGYALGLLLG
FT                   VGGAFGKLYGGPVLRDLLECYTTIVRAVPELVLILLLYYAGTDLLNQFLGAMGIGTVDI
FT                   SGLMAGIFVIGVVQGAYSTEVLRGAIKAVPAGQIEAARAYGMSPTKVLRRITLPAMLPY
FT                   AIPGLANLWLIATKDTALLAVVGFSELTLVTRQAAGTTKAYFLFFCAAGALYLVLTLVS
FT                   NLFIGVIERHARRGFAERR"
FT   gene            complement(219788..220567)
FT                   /locus_tag="NGR_c01950"
FT   CDS_pept        complement(219788..220567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01950"
FT                   /product="putative ABC transporter, periplasmic amino
FT                   acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01950"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23995"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFU4"
FT                   /protein_id="ACP23995.1"
FT                   /translation="MKKTLKLLALAAALSLTGAAASAEQIKVGIAAEPYPPFTSPDANG
FT                   NWEGWEVEFMKAMCAEAKLDCVITPVAWDGIIPALTAKKIDMIVGSMSITAERLKTIDF
FT                   SDKYYNTPTGIMGTKGEDIKPTPEGLAGKTLGVQVSTVHQAYATKHFAPAGVEVKEYQT
FT                   QDEANQDLAAGRVDAVQADAIALEAFLKSDQGKECCDYKGEVAQDVDVLGPGVGVGLRK
FT                   GETELKDKINAAIKAIRDNGTYDTFSKKYFDFDIYGG"
FT   gene            complement(220604..221377)
FT                   /locus_tag="NGR_c01960"
FT   CDS_pept        complement(220604..221377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01960"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01960"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23996"
FT                   /db_xref="GOA:C3MFU5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFU5"
FT                   /protein_id="ACP23996.1"
FT                   /translation="MTDAAQAIAVTDLHKRFGPLEVLKGVSLNARQGDVIAIIGGSGSG
FT                   KSTFLRCINMLELPSAGRVSVHGEEIRMKPDGHGGLMPADRKQVQRIRTQLGMVFQSFN
FT                   LWQHMTILENVIEAPVHVLGKSRAEAVETAEKLLRRVGLFEKRDAYPAFLSGGQQQRAA
FT                   IARALAIQPLVMLFDEPTSALDPELVGEVLSVIGDLAREKRTMILVTHEMKFARDVASH
FT                   IVFLHNGLIEEQGPPEAIFGAPKSERLKKFISSIH"
FT   gene            221356..222264
FT                   /locus_tag="NGR_c01970"
FT   CDS_pept        221356..222264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01970"
FT                   /product="putative HTH-type transcriptional regulator, TetR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01970"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23997"
FT                   /db_xref="GOA:C3MFU6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFU6"
FT                   /protein_id="ACP23997.1"
FT                   /translation="MPGPRPSSTRGSLGSQSFCRHENSSPGRSFVQHLRLVTLFHGGHR
FT                   CTCAAIIQVYNNCAADFLRTSPKCRPYSGARHEPDRFTDNHDLPERLLFPVAAMNRRSF
FT                   HRAPEGERRQELIEATLDCISEFGLKGATVRQIAVRAGVTAGLVRHYFDSKDQMVAEAY
FT                   RAVIASLTEKAKNVEGDPTTRLKDFIAINLTEPVADSRSVSLWAAFISQVRVDPVLAEI
FT                   HRDGYLAFRNALQDLLSDFLAAKGRPAGPEECRRYAIAINGLVDGLWVEGCLAGDLFRD
FT                   GELVSIAMASVEALLGLPMEE"
FT   gene            222299..223489
FT                   /locus_tag="NGR_c01980"
FT   CDS_pept        222299..223489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01980"
FT                   /product="predicted aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01980"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23998"
FT                   /db_xref="GOA:C3MFU7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFU7"
FT                   /protein_id="ACP23998.1"
FT                   /translation="MRYASITSRLADLGSGKWSLHIRARQLKASGTDLIELTIGEPDLP
FT                   PDRALLDECQRAMYAGRYRYSNGRGEPALVAALADKYRRRRADVTAENILCFPGTQTGL
FT                   FAVMLGLAEAGDGVLVGDPLYATYEGVIRSTGAHPVLVPLKPHHGFHMQAEDLERALTP
FT                   DCRVLLLNTPHNPTGAVLTAAEIAAIGDIARRHDLWIVCDEVYEELVFEAVFASPFDKP
FT                   DLAERTVVVSSISKSHAAPGFRSGWAVGPAEFTERLLPVSETMLFGQQPFIADMTAYAL
FT                   SHEIDTASQMREAYKRRAGRIAVALARTPGISVLPPEAGMFALIDVAGTGLSGEAFAWA
FT                   LLEEEGVAVMPGSSFGSQARDFLRVSLTVADELIDEACRRIAALAERHTSRKERRA"
FT   gene            223486..225099
FT                   /locus_tag="NGR_c01990"
FT   CDS_pept        223486..225099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c01990"
FT                   /product="predicted thiamine pyrophosphate protein, TPP
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01990"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23999"
FT                   /db_xref="GOA:C3MFU8"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFU8"
FT                   /protein_id="ACP23999.1"
FT                   /translation="MSVETKTVGEVLVDLLEANGVEVVFGIPGVHTVELYRGLAASKIR
FT                   HVTPRHEQGAGFMADGYARVSGKPGVALVITGPGLTNTITAMAQARQDSIPMLVISGVN
FT                   RRDSLGHGRGLLHELPDQQGMMKTLALYSHTLINPADLPLVVDRAFAVLLSGRPGPVHI
FT                   EIPTDVMAERIESRGTKPAAATRPRSDGETLQRAAILCAEASRPVILCGGGALTAEAEV
FT                   RGLAEQIGAPVVTTVNARGMLAGHPLRVPASPSLKAVRALLRDADLVLALGTEMGQTDY
FT                   DLYADGGFPMLRNLIRTDIDAAQLARGPQAALSVLSGARAATAGILGFLPGHTAARDGA
FT                   SRADATRKAALKELTPKMRAEVGIIDLIYKALPDCTIVGDSTQAVYAGNLYCDAPRQRA
FT                   WFNSATGYGSLGYAPPAAVGAAVADRARPVVCLVGDGGFQFSLAEIGSAVDAGARVIFL
FT                   VWNNDGYREIESHMVEAGVTPEGVKPSAPDFLLTAGAYGVPAERLAKIGDLPRALADAA
FT                   SRSGPSLIEIHQEKTAGVGG"
FT   gene            225260..225667
FT                   /locus_tag="NGR_c02000"
FT   CDS_pept        225260..225667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02000"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24000"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFU9"
FT                   /protein_id="ACP24000.1"
FT                   /translation="MDLLGGGSRNMQASRLLAVLWLFCASFAMQVITVGQSVSSRVGAQ
FT                   GGNVSAPDGGSPDRPAARQVSRAVALPELRIVGERPDGKSTLGGDPVAILAAEAATLPI
FT                   YEDIRPLFFTRTEVAVGSRHDSERIRGPPAV"
FT   gene            225770..228307
FT                   /gene="secD1"
FT                   /locus_tag="NGR_c02010"
FT   CDS_pept        225770..228307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD1"
FT                   /locus_tag="NGR_c02010"
FT                   /product="protein-export membrane protein SecD/SecF"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02010"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24001"
FT                   /db_xref="GOA:C3MFV0"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFV0"
FT                   /protein_id="ACP24001.1"
FT                   /translation="MRTSRWAVLAYVAIIIFGCLAAVPSVLTPAMREQFASVLPFKPVT
FT                   LGLDLRGGSHLVLEVDGAGLQKARLNSLLDDTRRVLRGERVSASSARISGNSVTVSVPD
FT                   PADREKVLPKLQELAAPVGGTAGFGGSAAEVDVATNGDVITLAMTEAGLADRMTKAVEQ
FT                   SLEIIRNRVDQVGVAEPLIQRIGSNRILVQLPGLQDPTRLRELLGSTAQMSFHMLDQTV
FT                   DITQPAPRGVDILPGADDGNKYPVESRVAISGERLEDAKVGFDQRTNQPVVDFAFDSLG
FT                   ARQFADITRENVGRPFAIVLDGKVLTAPVINEPILGGRGQISGNFTVEEATVLSALLRS
FT                   GALPAPLTIIEERSVGPNLGSDSIRMGLYTGLAGFGLVVTLMVVLYGAWGMIANVGLVL
FT                   HTIMTIGVLGLIGSTLTLPGIAGIILGIGMAVDANILINARIREETEAGAGAMKALDVG
FT                   FNKAYATILDSNVTTLAGTILLFWLGSGPVRGFAVTMMLGIIISMFTSVTVVRLLMREV
FT                   VVRRKMKKLEIPSLFGRVPHLPTFSFMKRRFQAIGFSAFLSISSVILFFTPGLNYGIDF
FT                   IGGIQVEAVSKDKIDLPTLRHSLEELNLGEVALQDFGGGQSVLVRVQRQPGGEQEQTAA
FT                   LNRIKDAVTTAIPGASMERTEVVGPTVSGELARSGFLAVGLAMVAILLYIWFRFEWHFA
FT                   VGAIAVLLLDITKTVGFFALTGIDFNLTAIAALLTMIGYSVNDKVVVYDRMRENLRKYK
FT                   SMPFSDLIDMSINQVIARCIFTSMATALSLVPMAIWGGEAVRSFAWPMIFGVIVATTSS
FT                   IYIGGPILLFLSRWWKDREAGRSSAQQPGTPAV"
FT   gene            complement(228547..228714)
FT                   /locus_tag="NGR_c02020"
FT   CDS_pept        complement(228547..228714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02020"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24002"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFV1"
FT                   /protein_id="ACP24002.1"
FT                   /translation="MRPFTVARQREREPQKAAVETVLDMSLSFGWAGHMAPRRFMNNAK
FT                   RSPSASPFAN"
FT   gene            228814..229023
FT                   /locus_tag="NGR_c02030"
FT   CDS_pept        228814..229023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02030"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24003"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFV2"
FT                   /protein_id="ACP24003.1"
FT                   /translation="MSKQVIEYGGEAVGVVVPDQDRLKFLAVKYHVWDLDAQRFGSADE
FT                   ARAAIRHLLAGKGAPPRHEVGAAA"
FT   gene            229334..230344
FT                   /gene="kpsF"
FT                   /locus_tag="NGR_c02040"
FT   CDS_pept        229334..230344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kpsF"
FT                   /locus_tag="NGR_c02040"
FT                   /product="sugar isomerase, KpsF/GutQ family protein"
FT                   /EC_number="5.3.1.13"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02040"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24004"
FT                   /db_xref="GOA:C3MFV3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFV3"
FT                   /protein_id="ACP24004.1"
FT                   /translation="MGLRHVKGEGHSPSAILDSIGRTLTTASNGIKALAEHLATDESFA
FT                   QSLVEAVELVGDGHGRVVVSGVGKSGHIGRKIAATLASTGTSAYFVHPTEASHGDLGMV
FT                   TSDDVLILLSWSGETAELANMLTYAKRFKVPIVSISSNRDSILARNSEIALVLPKVPEA
FT                   CPHGLAPTTSAMLQLAVGDALAIALLERRGFSAEDFKTFHPGGKLGAQLRLVHELAHVA
FT                   DQMPLLVVGRPMSEAVIEMSAKGFGVVGIVDEGGVLVGVITDGDLRRHMAGDLLGQPVE
FT                   EVMSCHPKVIQADVLASAAMEFMQEHKVTVLFLVDETGMPEGILHIHDLLRAGVA"
FT   gene            complement(230314..231645)
FT                   /locus_tag="NGR_c02050"
FT   CDS_pept        complement(230314..231645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02050"
FT                   /product="capsule polysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02050"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24005"
FT                   /db_xref="GOA:C3MFV4"
FT                   /db_xref="InterPro:IPR007833"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFV4"
FT                   /protein_id="ACP24005.1"
FT                   /translation="MTAGTTIQQRPRRTFLFLQGPSSPIFAKIATRLEAFGHICLRINL
FT                   NAGDQIFWRRGGAHNYRGTIDDWAACVEAFLRRHSVSDLVLLGEERPYHQAAIAAARRV
FT                   GAEVFVVEMGYLRPDWLTLERGGMSSNSHFPADPQQILSAAAGLPEPDWQRQHTQTFLA
FT                   EAAYDLLYNLPNVFLWFLFPGYRRHAIFHPLAEYAGWVRRLVVSKRQRRAADRLIGSLT
FT                   SASEPYFVYPLQLETDFQLRAHSPFNSQKEAIADILASFARHAPATSKLAIKVHPLDNS
FT                   LIPWRRIIAQQSAALGISERVIYLDGGNLDLLTEKSAGMVTVNSTAGLHALKQGRPVKI
FT                   LGRAVFDIAGLTDQQPLDAFWVAPRLPDAELSAAMFRLMAASIQVRGNFYSVAGTDAGA
FT                   EAIAERLHRNTVNKPGAFINPPPRQKPEKRAAASSQATPARKRS"
FT   gene            complement(231670..233289)
FT                   /locus_tag="NGR_c02060"
FT   CDS_pept        complement(231670..233289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02060"
FT                   /product="conserved hypothetical protein, contains
FT                   sulfatase protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02060"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24006"
FT                   /db_xref="GOA:C3MFV5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFV5"
FT                   /protein_id="ACP24006.1"
FT                   /translation="MKLLKGIGLALLPIQLHDYPAPLTLGCYLLSCGVIFFTDRFALPA
FT                   RERRRNASPHGRNQDIIDVLARLPVIALVFAGFFAISWRPLYAAAGVMSFFIIFTGISR
FT                   AKFKFIREPLVFSDIALVADVFKYKSIFYATSLNIVFWIVAVLYVFGVSGLYMYFEPTV
FT                   LPARDKMFWILVMIGIAAGPWLSLFYGPVNRPTAALVQRLMGKKVNVKMSTVRFGTFGS
FT                   VVFHFIVWLGVKREKIVAELSERLRAAVHELIGHEDAPLIVVWQSESFIDMRHFGVDTI
FT                   KLPAIDRLRQQAVQWGRLSNVFEGGYTLRTEFAVLSGLVPDDIHVDASYPYLRASHYAD
FT                   VVWPGKLKRAGWRTHFIHPYDRTFFLRHKAMPVLGFDTLTMLDAFDHDPSQDGLYVSDA
FT                   VLTARVLEETQKLPDDESGLFFVASMANHGPWEPGRVEALTNPVEIYLAILQQSDAALK
FT                   KLVDGLDRLDRPVWLVFYGDHAPLLKSFADPFPDPRTDYFIVPLAKARPANQRPKPPQD
FT                   EDPWNLLRALLKHANLHKDALQ"
FT   gene            complement(233376..234179)
FT                   /locus_tag="NGR_c02070"
FT   CDS_pept        complement(233376..234179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02070"
FT                   /product="follicular variant translocation protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02070"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24007"
FT                   /db_xref="GOA:C3MFV6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFV6"
FT                   /protein_id="ACP24007.1"
FT                   /translation="MTHVIITGGSSGIGLALASLYASRGARLSLIARSRDLLELAAQTL
FT                   VSKYGARQGDIHIEAADVANEAKIGPAIGRCIEALGPCDILVTSAGIVEPAPFLDASSA
FT                   AFRRQMETNFSGTVHAVRAVYPDMVQRRSGHIVMISSGSGLIGIYGYTAYCASKFALRG
FT                   FAEALRSEARCHGVGVSVGYPPDTETPQFEREIAERPREASVVMGVVRPWSAEAVARKI
FT                   VDGIDRKRFEIYFGLTLFLLGRFGPAVRPLINWWFDRAIERSRGR"
FT   gene            complement(234335..235714)
FT                   /locus_tag="NGR_c02080"
FT   CDS_pept        complement(234335..235714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02080"
FT                   /product="predicted aminotransferase, class I and II"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02080"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24008"
FT                   /db_xref="GOA:C3MFV7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFV7"
FT                   /protein_id="ACP24008.1"
FT                   /translation="MNSSLRENLLDRMRNTHQSSERNRMARSERDLPPAPRRQQARFED
FT                   LPEYKQVQAQKFASEQLGIANPFYRAHQTAAGATTMIDGRKLVNFASYDYLGLNRHAHV
FT                   LERARETIETFGISASASRLVAGERPVHVELEERIARFYGVEAAVCFVSGYLTNVAAIG
FT                   CLLGPKDLVIHDEFIHNSALAGIKLSGAARRLFKHNDTADLEHVLRTVSGDYRHILVIV
FT                   EGIYSMDGDVANLPALLKLKAEFGFWLMVDEAHSLGVLGRRGKGLAEHFGVDPHEVDIW
FT                   MGTLSKTTSSCGGYIAGSEALAAVLKASAGGFVYSVGLAPVLGASAVASIDVLEREPER
FT                   TAALRRNGALFLKLAKEAGLDTGLSGGYSVVPVIVGDSLRAVQLSNDLLAAGINVLPII
FT                   HPAVPEGMARLRYFITSEHTEEQIRRTVTLTAERLKDLVERNFGLGGVDIDQMLKTLSA
FT                   R"
FT   gene            complement(235747..243249)
FT                   /locus_tag="NGR_c02090"
FT   CDS_pept        complement(235747..243249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02090"
FT                   /product="beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02090"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24009"
FT                   /db_xref="GOA:C3MFV8"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFV8"
FT                   /protein_id="ACP24009.1"
FT                   /translation="MTVEIIGRACLAPGAQSPQALFKILRQGMCTVSSVPGDRWDLARF
FT                   WHPVMGTQGKTYSFAAGVLETIYDFDPAVFGMSQREAMYMDPQQRVLLQLAWRALEDAN
FT                   ISVASLHGENVGVYIGASSLDHANLTVEDPAAAGPYFMTGNTLSIVSNRISHVFGLSGP
FT                   SMTVDTACSSSLVALDQAMRALNAGEIDTAIVGGVNILAHPLPFVGFAQARMLSPEGLC
FT                   RAYDNDGAGYVRAEGGVVFVLRRSDRARREKDRSYARIVASGVNSAGRTNGISLPSREA
FT                   QANLLKAIYEGNGIDANQVAFVEGHGTGTKVGDPAEVWSIGTVIGAKRRAPVPIGSIKS
FT                   NIGHTEPASGLFGMMKAVLALEHNYLPASLHFDTPNEHIDFEGLNVRVTANPIELLKGK
FT                   RARLAGINSFGFGGANAHVVISDPDPVPQEKAPATSAGHVFLASAHTQSSLENLLKDYK
FT                   ASFANASKEEARAIIAASGANRTHMRHRFAARSDHPEDIVRAIASHLDKPGSDIGEVGE
FT                   APVKNAQVAFVFSGNGSQWAGMGVDAFRENLHFRQSFTSISALFKFHSDIDLKDLLTDP
FT                   ELDKKLADTKIAQPLLFAIQAALSDSLVAMGVKPAAVFGHSVGEIAAAYAAGALTLVDA
FT                   VSIVAKRSLHQDLLAGQGTMAAVMLGEEAAAAFAEARGLDEVCVAAVNAHNSVTISGPA
FT                   HEVTAFRDAARKAKIPVQILDINYPFHHPIIDQAKEAFLADIPDIAPRRTELTYLSTVT
FT                   GDALDGTELDPDYWWKNVREPVRFQAATDAALALGCRLFIEISPRPILASYVKETIKQA
FT                   AAPAMVVATLLRDAAEKGQDPISASMARAVAHGAAVDRIRVYGKRDALIELPSLPFEPV
FT                   ELRPQATTDATDLFGRSSKPYRLTGWRGDPNSGSWKNHVDAHLFPDLAEHVVDGKAILP
FT                   GSGFIEVAVSAAQQYYGSDEVEITNLEIVRPLELSDSRIMELSTILSPETGDIEIRSRE
FT                   RLSEDDWTVHAVARSRKPIARANTRHASISSLAKSGIVTPAKAYDTAKQFGLDYGPHFQ
FT                   LLARAVAYGDRLIEVELKAPAGSGHPFVSYALHPISVDATFHGLVALFDRFTGDKGGAP
FT                   YIPVRFGSVRVVNAGRPIARATIEIERVSANSIKARFHFYDAAGEPIAHFDDCRFRRTY
FT                   LRKHKALDGLSFHYETVLSNVILPGTKVAGTVPAKLSEPADAESGVDNATLLFNAAIYR
FT                   ACHEIALKLARGRSTIPGNGLPGDFAFQCFLTNCLYALEDAGLCEHQDGNWKVAPEFTL
FT                   PTVAEILGELYGERPDRAVEAVLINNAHAEALGRLTTLLAGTASGEAAAFNAGFISEAT
FT                   LDHQAVHSVASRSRMDQILGMVERALAAQVEGARLRIVELGSVSAGFTRRLADLAARHG
FT                   TTLSVVEPRDNAQRNLEIAFEEDAHVRILKKSEFAAIGPFDLAVSASDNLYQLIEEEAG
FT                   IRTALRSALRESGALVAAVSAPSIFSDFALGLSEGWFERSQTAEFPIGKRAAVSHWQKC
FT                   LAELELADVSVSDCECPHGNAILIEARGTAVAAGPLASAAGGIPYLLVETGVRGSSAAA
FT                   GAIPVAVSGDMVADIDLLGTALDGFGEKPVRAVFLSATTDHVGDGDSALLQTQVLALSA
FT                   FAETLKQRVANAELVGEARPRLVLVAPGGAPVSESASSGVNSGLWTFVRVLQNEYEFLD
FT                   VHSLDLADQTASREEMLASALPLLTIEGSNREWLLDRATGLISEIRAVSGPAAKSEGKI
FT                   SAFSAATIRQRVSSQVSSITWEETDVPRAGPGEIVVSVAATGLNFRDVMWAMGLLPEEA
FT                   LEDGFAGATIGMELSGHVVEVGEGVDDLAIGDAVMAIASAAFSTHAVVSRAGVAKLPQT
FT                   ISPVAAATLPVAFLTAYYAMVELGRIRSGETILIHGAAGGVGLAALQVAKLKGAKVIAT
FT                   AGTREKRRFLTMLGADHVFDSRSLGFVNDVRSVTGGEGVDLVLNSLFAEAMEQSLALVK
FT                   PFGRFLELGKRDYYADSKIGLRPFRRNVSYFGIDADQLLVNQPELTKQIFMEIGELFDQ
FT                   GRLTPLPYRAFDFDEIGNAFRLMQNAGHIGKIVVLPPVAGKHEIAAKPRRGMKVDPDGM
FT                   HLVVGGIGGFGLVAANWLVEKGARNIALCSRRGQPDTATSAMVERWKKAGVAASLHACD
FT                   VTDATAVEALLATLRGQAPLRSIVHAAMVLDDALISNLTRERNRPVIDVKAKGAAILDR
FT                   LTRQDTLDNFILFSSATTLVGNPGQANYVAANGYLEGLARTRRAAGLAGLAVGFGAIAD
FT                   AGYLTQNADVNDLLAKRIGKTALKAHMALDMVESHIAADPGSIDAAVVMISEIDWGAAR
FT                   NLPVTRNALFEVILRSADQHASGTEGTKMDLVAMIEGKAPQEAEDILFDLVAGEIAAIL
FT                   RVAKDTVTRGKILKEIGLDSLMAVELGISFQQNTGFDMPLSGVADNTTVGDVARKLYEK
FT                   VSKRDQSDDGEAGDDKLVTELTQRHVGAAKEKALSQ"
FT   gene            243617..244840
FT                   /locus_tag="NGR_c02100"
FT   CDS_pept        243617..244840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02100"
FT                   /product="putative polysaccharide biosynthesis/export
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02100"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24010"
FT                   /db_xref="GOA:C3MFV9"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFV9"
FT                   /protein_id="ACP24010.1"
FT                   /translation="MESSLCRIRSEVVKRVTALLLCTALAGCQAVPGEGPLTSDIVAEA
FT                   GQSGSQIGRKNATVFDIIDIDGQSARLVSEYVATTLSRRFGIGGGVGQVVIGVGDQLKV
FT                   TIFEAGSDGLFSTTESKQTSIDLVVQPDGKAAIPYVGSVRFAGLTLEQARQAILDALKQ
FT                   KAVEPDVIVTSTSTASRIVTVSGAVGRPSVVPLNLVSETINEVIAKAGGPSAQPYETYV
FT                   TLVRGKKTGTVLLKSIIESPSENIHVKQGDQIFVTRDPRTFTILGQVRANQRVEFGAND
FT                   LNLLEAVALAGGGADRTIDAKGYFVFRYEEPDIVMSLLGRERFNTMLSKGMQPDRVGRY
FT                   PIVYRFNMTNPDSLIVGQTFPIKNRDVIYASRHPSVDITKFMDFIARPIGIANSGVNIA
FT                   DNLDDLNN"
FT   gene            245078..245677
FT                   /locus_tag="NGR_c02110"
FT   CDS_pept        245078..245677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02110"
FT                   /product="pyrazinamidase/nicotinamidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02110"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24011"
FT                   /db_xref="GOA:C3MFW0"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFW0"
FT                   /protein_id="ACP24011.1"
FT                   /translation="MAEDALIVIDMQNDFCPGGALAVAGGDEIVPVVNSLIEKAKHVIL
FT                   TQDWHPAGHSSFASSHPGKAPFQTVTMPYGEQTLWPDHCVQGSPGADFHPALRWTTAEL
FT                   VIRKGFRTGIDSYSAFFENDHRTPTGLAGYLRERGISKVSLCGLATDFCVAFSALDAVA
FT                   EGFSTSVVLDACRGIDLNGSLAAMTRRMRDAGVELI"
FT   gene            245743..247047
FT                   /gene="pncB"
FT                   /locus_tag="NGR_c02120"
FT   CDS_pept        245743..247047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="NGR_c02120"
FT                   /product="nicotinate phosphoribosyltransferase"
FT                   /EC_number="6.3.4.21"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02120"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24012"
FT                   /db_xref="GOA:C3MFW1"
FT                   /db_xref="InterPro:IPR006406"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MFW1"
FT                   /protein_id="ACP24012.1"
FT                   /translation="MPKTDIARRVYNHTWKLDPIIRSLLDTDFYKLLMLQMIWQLYPDV
FT                   DATFSLINRTKTVRLAEEIDEQELRDQLDHARTLRFSKKEMIWLAGNTFYGRKQIFSPE
FT                   FLSWLARFRLPEYELSRRDGQFELTFRGRWVETTMWEIPALAIINELRSRAAMKGLGPF
FT                   TLDVLYARAKAKMWSKVEQLRQYPNLRISDFGTRRRHSFLWQRWCVEALKEGIGASFSG
FT                   SSNVLLAMDNDLEALGTNAHELPMVAAALARNDKELAAAPYKVLQDWNQLYGGNLLIVL
FT                   PDSFGTAAFLRNAPDWVADWTGFRPDSAPPVEGGEKILAWWKKKGRDPRDKLLIFSDGL
FT                   DVDTIIKTYRHFEGRVRMSFGWGTNLTNDFAGCAPTEIGGLNPISIVCKVSEANGRPAV
FT                   KLSDNPRKATGDPAEVERYLKFFGTEDFVEQTVRV"
FT   gene            247325..247537
FT                   /locus_tag="NGR_c02130"
FT   CDS_pept        247325..247537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02130"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24013"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFW2"
FT                   /protein_id="ACP24013.1"
FT                   /translation="MRQAYSPDDVDVMRGALDVWCALHNVGKDGAEADRAARRILDLMD
FT                   RKKCSADELLAQLGDFRPEPRQRAF"
FT   gene            complement(247663..247809)
FT                   /locus_tag="NGR_c02140"
FT   CDS_pept        complement(247663..247809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02140"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24014"
FT                   /db_xref="GOA:C3MFW3"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFW3"
FT                   /protein_id="ACP24014.1"
FT                   /translation="MIKSGLGATIAVLVVSIAVSGILHVALSQHRTQANAAVSGEITSS
FT                   IPR"
FT   gene            248060..250324
FT                   /locus_tag="NGR_c02150"
FT   CDS_pept        248060..250324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02150"
FT                   /product="penicillin-binding protein 1A"
FT                   /EC_number="2.4.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02150"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24015"
FT                   /db_xref="GOA:C3MFW4"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012413"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFW4"
FT                   /protein_id="ACP24015.1"
FT                   /translation="MAQSDAASKIGPENQGPEEAEPSRDHPGRSDGAAFPKTRKALAGL
FT                   GRALTRLGRALRAEVPVAAHRAGEKSKAAALGAFERLRRTSSGKAGSSASAGRSASRWL
FT                   KARRGAASEDRQVMPKRPIGRRAILLRSAAAATLASFVLLAVVFAWALRDVPWNEIAKG
FT                   SLKPVVVLEAADGKPLVSQGPFQGSYAARKDFPPHLVEAVLAREDRRFYEHSGIDLRGI
FT                   ARAIYTNLGAGEVVQGGSTITQQLIKILYLERDRTWKRKIQEAVIAFWLERKLGKDEIL
FT                   TRYLNNIYLGAGATGVPAAARIYFDKEVQDLNIGESAMLAAIIRAPSQLNPLTNPEGAR
FT                   QQAELVLDAMVKGDRITPEEAKVARADVGKLQPTSPAIRSGSWFADWIMQDARELAGPY
FT                   RGTIKVRTTMAPRLQAIAEKVVADALKREGPKAGASQAALVAMTPEGAVVAMVGGRDYT
FT                   KSTFNRAVQAMRQPGSAFKLFVYYAALKRGLTPFDPVEDAPIEINGWSPENFGGGYRGV
FT                   VSIAEAFARSLNAATVALAMEVGIDEVIAAARELGIDAKLADTPSLALGSSEVNLLDLT
FT                   GAYASVRAGRAPIEPWGIEALHAEGQPQAFRVGPSREAATDISQYRPDLVSLLRLVVQR
FT                   GTGREADIGTFAAGKTGTSQNHRDAWFVGFTEPLIVGVWVGNDDETPMKDVTGGKLPAR
FT                   IWKNFMTAALAAGTPEESEAQAAGSAPACNFRACARAYRSFRPDDCTFQPYYGPRRLCE
FT                   K"
FT   gene            complement(250382..250588)
FT                   /locus_tag="NGR_c02160"
FT   CDS_pept        complement(250382..250588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02160"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24016"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFW5"
FT                   /protein_id="ACP24016.1"
FT                   /translation="MMTMVHTETVDRRMSDDDDVELALALACELLEMTREAIIRLIIRE
FT                   WLQGYGFLPIQELDEGSETEAGT"
FT   gene            250837..251283
FT                   /locus_tag="NGR_c02170"
FT   CDS_pept        250837..251283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02170"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24017"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFW6"
FT                   /protein_id="ACP24017.1"
FT                   /translation="MRGHHFTLSPTCPRRTSGFGRSLKPINRPGGQAPLRRIGSRGADP
FT                   SPRAAEGIRQCSGPAVAHTRGGLFSGVVAQHSAPPMPLRKSPKSAAEGTSGGVLDVPPW
FT                   HMRITDDLGRNLLGANVLTGIAPEQTAHEYMRLAKADQQERSAA"
FT   gene            251911..252156
FT                   /locus_tag="NGR_c02180"
FT   CDS_pept        251911..252156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02180"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02180"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24018"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFW7"
FT                   /protein_id="ACP24018.1"
FT                   /translation="MSKYEGLTYRLARERLREIILTFKEIESLIGAALPKSARRPQFWA
FT                   NTSDPEQSRPGNRAAREAGCRSFLLAGHDKVRFVRA"
FT   gene            252165..252563
FT                   /locus_tag="NGR_c02190"
FT   CDS_pept        252165..252563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02190"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24019"
FT                   /db_xref="GOA:C3MFW8"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFW8"
FT                   /protein_id="ACP24019.1"
FT                   /translation="MAWLSEVLDQTTVLSLLAGIVVGLPAYFVVSALIRDDRPSPAPRR
FT                   SPRRRKRSSIPGIAVAAAIALFGVSQYVPLIPGCDIKGNVSYNSGERIYHIPGQEDYGQ
FT                   TRVNYFDGERWFCSEASAREAGWRRAYN"
FT   gene            complement(252837..252911)
FT                   /gene="trnT2"
FT                   /locus_tag="NGR_c02200"
FT                   /note="tRNA-Thr2"
FT   tRNA            complement(252837..252911)
FT                   /gene="trnT2"
FT                   /locus_tag="NGR_c02200"
FT                   /product="tRNA-Thr"
FT                   /note="codon recognized: ACC"
FT   gene            253174..253392
FT                   /locus_tag="NGR_c02210"
FT   CDS_pept        253174..253392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02210"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02210"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24020"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFW9"
FT                   /protein_id="ACP24020.1"
FT                   /translation="MHMQNDDDKDHAPGPRRGAKAGKSEAEVKRERLAKTLRDNLQRRK
FT                   QQARARRAGDADETSGLPAAKTDESDD"
FT   gene            253606..254898
FT                   /gene="murA"
FT                   /locus_tag="NGR_c02220"
FT   CDS_pept        253606..254898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="NGR_c02220"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02220"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24021"
FT                   /db_xref="GOA:C3MFX0"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MFX0"
FT                   /protein_id="ACP24021.1"
FT                   /translation="MDRIRIVGGNQLHGVIPISGAKNAALPLMIASLLTDDTLTLENVP
FT                   HLADVEQLIRILGNHGADISVNGRRERQGESYARTIHFTSRNIVSTTAPYELVSKMRAS
FT                   FWVIGPLLAREGKARVSLPGGCAIGTRPVDLFIEGLTALGANIEIDGGYVNATAPEGGL
FT                   TGGRYVFPKVSVGATHVLMMAATLANGTTVIGNAAREPEVADLAKCLNAMGAKITGAGT
FT                   GTITIEGVRSLSGARHRVLPDRIETGTYAMAVAMTGGDVILEDTEASLLDTALEAIRRA
FT                   GAEISETNSGIRVVRNGAGIRPVDIVTDPFPGFPTDLQAQFMGLMTKSSGVSHITETIF
FT                   ENRFMHVQELARLGAKISLSGQTAKIEGVGRLKGAPVMATDLRASVSLVIAGLAAEGET
FT                   MVSRVYHLDRGFERLEEKLTRCGAHVERVSD"
FT   gene            255039..255479
FT                   /locus_tag="NGR_c02230"
FT   CDS_pept        255039..255479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02230"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02230"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24022"
FT                   /db_xref="InterPro:IPR021335"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFX1"
FT                   /protein_id="ACP24022.1"
FT                   /translation="MDALKLLALDEEDLGVVSAHVQDAVFKVAGIHYDARRRQFSLVIN
FT                   RFVWETAEGKRKNFERRRALLLFKCVTAVRSLGFDRADMEAVLDLLAVQFLVKGEGPDG
FT                   TVELVLAGEASIALDVECIEAQLADTGGAWETAFRPRHPEGD"
FT   gene            255437..256819
FT                   /gene="hisD2"
FT                   /locus_tag="NGR_c02240"
FT   CDS_pept        255437..256819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD2"
FT                   /locus_tag="NGR_c02240"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02240"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24023"
FT                   /db_xref="GOA:C3MFX2"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFX2"
FT                   /protein_id="ACP24023.1"
FT                   /translation="MGNRVQAASSRRRLSRAPATTKRIIALAIRLNFLDSGFERDFAAF
FT                   LTTKREVSEDVNAVVRAIIDDVRARGDAALADYSARFDGVDFSVTPMAVSAAEIDAAID
FT                   AVEPEVLGALKVAATRIEAHHRRQLPKDDLYEDKMGVGLGSRWTAIDAVGLYVPGGTAS
FT                   YPSSVLMNALPAKVAGVPRIVMVVPTRGGAINPAVLAAARLAGVEEIYRIGGAQAVASL
FT                   AYGTETIAPVAKIMGPGNAYVAAAKRQVFGTVGIDMIAGPSEVLVIADRDNDPDWIAAD
FT                   LLAQAEHDAGAQAILITDDAAFGASVEQAVERQLKTLPRSETATASWRDFGAVILVPDL
FT                   DKAVPLANRIAAEHLELAMADPDSMVPKIRNAGAIFIGRHTPEVIGDYVGGSNHVLPTA
FT                   RSARFSSGLGVLDYMKRTSILRLGPEQLRILGPAAIALAKSEGLEAHARSVAIRLNFGE
FT                   EG"
FT   gene            256816..257292
FT                   /locus_tag="NGR_c02250"
FT   CDS_pept        256816..257292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02250"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24024"
FT                   /db_xref="InterPro:IPR008321"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFX3"
FT                   /protein_id="ACP24024.1"
FT                   /translation="MRADRHLRLCDVVLDETIGRSTPDVEHERAVAIFDLLEENLFEPA
FT                   GHPGGPYRLNLSLVDSKLVFAISTDGGEAVATHILSLTPFRRIVKDYFLICESYYEAIR
FT                   SATPSQIEAIDMGRRGIHNEGSQTLMDRLSGKIRLDFDTARRLFTLVCVLYWRG"
FT   gene            257334..257765
FT                   /locus_tag="NGR_c02260"
FT   CDS_pept        257334..257765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02260"
FT                   /product="putative low molecular weight tyrosine
FT                   phosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02260"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24025"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFX4"
FT                   /protein_id="ACP24025.1"
FT                   /translation="MPRSILFMCGMNAIRSPMAEALAKAALPKGTYVASAGVRHGERDP
FT                   FVDVVLDEVGLTIGRHQPHTLDELEDDYFDVIVTLAPEAHHKALELTRSMAVDVVYWPT
FT                   PDPTVATGTRDQIVGAYRAVRDHLAGLIASRLAGRGQVG"
FT   gene            257899..258162
FT                   /locus_tag="NGR_c02270"
FT   CDS_pept        257899..258162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02270"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02270"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24026"
FT                   /db_xref="GOA:C3MFX5"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFX5"
FT                   /protein_id="ACP24026.1"
FT                   /translation="MRGASAVEHEKAQSFMAKEEVLEFPGVVTELLPNATFRVKLENDH
FT                   EIIAHTAGRMRKNRIRVLAGDKVLVEMTPYDLTKGRITYRFK"
FT   gene            258204..258824
FT                   /locus_tag="NGR_c02280"
FT   CDS_pept        258204..258824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02280"
FT                   /product="predicted septum formation protein, Maf-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02280"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24027"
FT                   /db_xref="GOA:C3MFX6"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFX6"
FT                   /protein_id="ACP24027.1"
FT                   /translation="MTVTQKLILASGSPRRVELLAQAGIEPARLLPMDLDETPKRAEHP
FT                   RSLARRLSAEKAKAALAAVKGEPSWDGSYILAADTVVCVGRRILPKPELVSEASSALHL
FT                   LSGRSHRVYTGICLVTPDRTIRQKVVDTKVRFKRLSGLDIETYLASGQWRGKAGGYGIQ
FT                   GIAGSFVVKLVGSYTNVVGLPLYETVNLLIGEGYDVHGRWLEG"
FT   gene            258831..259040
FT                   /locus_tag="NGR_c02290"
FT   CDS_pept        258831..259040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02290"
FT                   /product="hypothetical protein contains zinc-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02290"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24028"
FT                   /db_xref="GOA:C3MFX7"
FT                   /db_xref="InterPro:IPR005584"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MFX7"
FT                   /protein_id="ACP24028.1"
FT                   /translation="MSGEGKKHGSNVEPLRPTRPCPECGRPSVRERYPFCSERCRNVDL
FT                   NRWLSGSYAIPVADDESKADDEDR"
FT   gene            259386..259461
FT                   /gene="trnF"
FT                   /locus_tag="NGR_c02300"
FT                   /note="tRNA-Phe"
FT   tRNA            259386..259461
FT                   /gene="trnF"
FT                   /locus_tag="NGR_c02300"
FT                   /product="tRNA-Phe"
FT                   /note="codon recognized: UUC"
FT   gene            complement(259599..260963)
FT                   /locus_tag="NGR_c02310"
FT   CDS_pept        complement(259599..260963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02310"
FT                   /product="putative transmembrane response regulator protein
FT                   with GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02310"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24029"
FT                   /db_xref="GOA:C3MFX8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFX8"
FT                   /protein_id="ACP24029.1"
FT                   /translation="MGPLTYETAFERDPPPGAHLASGSCSTKWANMDVQESAISTDRVS
FT                   PSTKLQVQDPAVLSEVERLLAGRTRDIRLKGKLRLLFQERSWPRTAKIVRAWMTWVVVL
FT                   DVVTLALNAILLPKAIALSMLLPACLLPPAAMATAFVWQRPRAQWLQRISIIAGLFLIF
FT                   LSVALVGVSAGGEFYERHLNIMLFVAITAIIIFGVPLNWTVTVASLALGLYLVFQLQNP
FT                   SLEKGSAVAATLFFASGIIATVVARRTMTILAQKTFLLELRDRSRVAELADANARLERL
FT                   ARTDPLTGISNRRWMMETLDHLWSDGMERRGCAMLMCDIDEFKNLNDRLGHAEGDRCLV
FT                   KVAGIIQSSVRRNRDHVARYGGEEFLIVLPGVDEREAIAMGERIRGSVEAASLPNPASR
FT                   VLPYVTLSIGVAAQRPGDEIIPPERLQNQADAALYLAKQAGRNRVVLHKAGALGT"
FT   gene            complement(261079..266142)
FT                   /locus_tag="NGR_c02320"
FT   CDS_pept        complement(261079..266142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02320"
FT                   /product="conserved hypothetical protein, contains ice
FT                   nucleation protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02320"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24030"
FT                   /db_xref="InterPro:IPR026664"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFX9"
FT                   /protein_id="ACP24030.1"
FT                   /translation="MTSIISSLSVTQIKNLSTTAVASLTTEDVAAMTTAQVKALSSTQI
FT                   AALDTEDVAIFSTAQLSAIAATSVAGISLDQLAAIDSAKIASLATSQVAALSSAQIDGL
FT                   SSDQAEALTTSQVAALGSAQLAAFSSEDITTFSTAEIAAISVTALAGLSTDNLAALSTD
FT                   QAAALKTTQVAALKTTQVAALTTDQIGALSSSQIAVLSSTQVKALSTDNIAALSTDQVA
FT                   ALNSKTVAALTSAQIDALSSDQAEALTTAQVASLTSTQVAALASEDIATFSTADIAAIT
FT                   VTALTGLSTDNVAALSTDQAAALKTTQVAALKTAQVAALTSDQVVALTSSQVGVLSSTQ
FT                   ISALSTDNVAALTTDQVAALNSKTVAALSSAQIGALSSDQVEALSAVQIAALDSADIAA
FT                   LASEDIATFSTSEIAAITATALSGLSTDNVAALSTDQTAALKTSQIAALKTAQIAALTS
FT                   DQVVALTSSQVGSLSSTQISALTTDNVAALSTDQVAALNSKTVAALSSTQIGALTSDQA
FT                   EALTTAQVAALTSTQIAAFASEDIAAFSTADIAAITVTALGGLSTDNVAALSTDQAAAL
FT                   KTTQVAALKSTQIAALTSDQVLALTSSQVGALTSTQVKALSTDNVAALSTDQVAALNSK
FT                   TVAALSSAQVDALSSDQAEALTTAQVASLGSTQIAAFASEDIAGFSTADIAAITVTALT
FT                   GLSTDNVAALSTDQAAALKTTQVAALKTAQIAALTSDQVVALTSSQVGALTSSQVSAIS
FT                   TDNIAALSTDQVAALNSKTVAALTTAQIEALSSTQVEALTSVLVGALSSTQLSVLASED
FT                   IAAFSTADIAAITVTALGGLSTDNVAALSTDQAAALKTTQVAALKSTQIAALTSDQIEA
FT                   LSTAQIGALTSTQASAISTDSLAALSTDQVAALNTKTLASLSTVQIDAMSSDQLEALTS
FT                   AQVAALTMAQLGALASEDVATFSTADIAAITVAALAGLSTDNVAALSTDQAAALKTTQI
FT                   AALKTAQIAALTSDQVVALTSSQVGALSSTQISALSTDNVAALSTDQVAALNSKTVAAL
FT                   SSVQIDALSSDQAEALTTAQVAALGSTQLAAFASEDLATFSTADIAAITVTALVGLSTD
FT                   NLAALSTDQAAALKTTQVAALSTAQVGALTSDQVVALTSSQVGALTSTQVKALSTDNVA
FT                   ALSTDQVAALNSKSVAALTSVQIEALTSDQAEALTTAQVASLTSTQVAALASEDIATFS
FT                   TADIAAITVTALAGLSTDNVAALSTDQAAALKTTQVVALKTAQIAALTSDQVVALTSSQ
FT                   VGALTSTQISALSTDNVAALSTDQVAALNSKTVAALSSTQIEALSSDQAEALTSAQIAA
FT                   LDSADIAALASEDIATFSTSEIAAITATALLGLSTDNVAALSTDQAAALKTAQIAALKT
FT                   AQIAALTSDQVAALTTSQVGTLSSTQIAVISTDNIAALTTDQVAALNSKTVAALTSTQI
FT                   EALSSDQAEALTTAQVAALGSAQVAALASEDLATFSTADIAAITVTALTGLSTDNLAEL
FT                   STDQAAALKTTQVAALSTAQIGALTSDQVAALSSAQIGALTSTQLTALSTDNVAALTTD
FT                   QVAALSSKVIGALSSDQIDALSTDQVEALTSAQVAALDSADIAALSTDDIATFSTADIA
FT                   AISTTALAGLSTDDIMSLSSDQLVAVTTTQVEALDDSQVEAIIAAYQAI"
FT   gene            266825..268882
FT                   /locus_tag="NGR_c02330"
FT   CDS_pept        266825..268882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02330"
FT                   /product="conserved hypothetical protein contains
FT                   tetratricopeptide protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02330"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24031"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFY0"
FT                   /protein_id="ACP24031.1"
FT                   /translation="MTIYTHLASDPASPLAGFLERARQQRLPLTELFQFAESFNAAGQR
FT                   EQAAELYKSWIAYNDSNPLLHLVYFNYSVTLRQMGDLAGSIHALRACLKFEPRFGQGHI
FT                   NLGRALEDAGLTGQAIQQWQVYAEATSEITPERAAHRLMVLQHMGRVLENAGLMEEAES
FT                   TLWKAIELRPDKTEAGQHWTSLRQRQCKWPTLAPSEHVSARQLLDALSPLTLACYADDP
FT                   VFQLAKAYRYCKSLVGRPDLSGFPKLQPRQKSGTGQRLRVGYVSSDLRDHAVGFALSEV
FT                   FETHDKSSVEIYAYYCGEARTGDATQTRMMSTIDCWRDISAISDSDAAKQIIADEIDIL
FT                   VDVNGYTKHARTRIFAYRPAPVIVSFCGYPGTMGSPFHQYVIADEQIIPPENEIYYSEK
FT                   VLRIPCNQPVDRKRQIAPRPSRAEAGLPEDGFIFACFNGAQKITAACFDRWMAILAATP
FT                   GSCLWLLGGGEDVDQRLKQAAQQRGVAPERLIFASKAPNPKHLARIGLADLFLDTFPYG
FT                   AHSTAGDALTMGLPVLTFPGNGFASRFCSSIVAAAGVPELICEGPDDFVRKAIGFAKDR
FT                   QSLASVREALESRRDASVLRDIPALVRRLEELLWQMQGECERGETPVPDLSNLDIYYEV
FT                   GAEIMKENVEFVDSAAYRQRYVEKLAEWHAFSPIPFDSRLWTAATAGARR"
FT   gene            268914..270167
FT                   /locus_tag="NGR_c02340"
FT   CDS_pept        268914..270167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02340"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24032"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFY1"
FT                   /protein_id="ACP24032.1"
FT                   /translation="MAPVILVTFAGRQKRMEILTRYIHSAMDAGIIDEWHVWDFTRSQQ
FT                   DHEWVTREFGPVRYMGSAAPYQSNGSIAPNQALRLGATITNDLHLAIVPNDGSDDYFEL
FT                   VVGGWSNSHSVLRKLPLSQLRSFDRNDVPALWSRPTPGILSPGTANQIVINVDAAGVPS
FT                   LHVNNVAIGHWPELDLSAGASVMVRGGWGADLELGNVRSRIQRFVGNPNEQMPYWQAYD
FT                   YYAKRLKIFSDSIFLKCDDDIVYMDLEKLSDFIEFRRTNPKYIVVSANVVNNGVCAHWQ
FT                   QVAGSIPVGVGHFERPPGGFGGSLWQSAERANELHDYFLQTNDKHLPLPSKVIEWTERQ
FT                   SINFIAWLGKDLVHMALPKGDDERALTVDLPLLLDRPTAIYSDFTVSHLSFGPQEQGLA
FT                   LDRLIDAYDELMRNALAA"
FT   gene            270217..271374
FT                   /locus_tag="NGR_c02350"
FT   CDS_pept        270217..271374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02350"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02350"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24033"
FT                   /db_xref="GOA:C3MFY2"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFY2"
FT                   /protein_id="ACP24033.1"
FT                   /translation="MRASGRIGIVGAGLSGAVIGRELAEAGHQVEIFDAREHIAGNCHT
FT                   ERDEGTGVMIHVYGPHIFHTDDREVWDYVNSFQTFMPYKNRVKATSRDQVFSLPVNLHT
FT                   INQFFGKTFRPDEARTFIEEQADTSIEDPKTFEEQALRFVGKDLYEAFFQGYTQKQWGC
FT                   SPTDLPASILKRLPVRFNYDDNYFAHKYQGMPENGYTDMIGRILDHPNINVSLKTRFVR
FT                   AQKDDFAHVFYSGSLDGYLDHEFGPLGYRTLDFERFEYDGDYQGCAVMNYGDVSVPYTR
FT                   ITEHKHFSPWEEHKGSVCYREFSRECGPEDIPYYPIRLVKDKEQLAQYVERASRETAIT
FT                   FVGRLGTYRYLDMDVTIREALDTARLYLARKAENASMPVFLHSPI"
FT   gene            271818..278894
FT                   /locus_tag="NGR_c02360"
FT   CDS_pept        271818..278894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02360"
FT                   /product="conserved hypothetical protein, contains ice
FT                   nucleation protein domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02360"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24034"
FT                   /db_xref="InterPro:IPR026664"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFY3"
FT                   /protein_id="ACP24034.1"
FT                   /translation="MTSIISSLSPTLIKSYSTAAVAAWTTEDVASLTTKQISAMSSAQI
FT                   AALDTEDVDVLSSRQLGAISPSAIVGLTLEQLAVLDQSDIESFGTSQVAALTTKQIDGL
FT                   SAEQAEALSSTQVGALSALQLSVLTEEDLESFSTADIAAIGAKAITGLPADVVASLSTD
FT                   QIAGLSTRAVAALSTAQIAALSTDQLAALTTAQVTALKASQIEALGTDDIATLSTQQMA
FT                   ALSASAISGLSTKQIAALSVDQIEALTVSQVKALTAAQLGSLETDGIAAFSTAEIAAIS
FT                   RAVWGLTTEAFAALSTAQVAALNTAAVASLTTAQMAALSADQAEAMSVLQVKALNSRQL
FT                   AALGTEGIATFSTGEIAAIANLAIKGVSTDAIAALSTAQVAALSTSAISGLTTAQSEAF
FT                   SSDQAAVLSAAQLRTLSSAQVAALGTDNIEALSTDQIAALNTKGVMGLTTDQVAALSTD
FT                   QVEALSVTQVKALNALQLEALGTDGLAMFSTGEIAALSNKAILGVDAEVIASLSTDQIA
FT                   ALSTSAVASLTSAQLAALSTDQAEALSVSQVKVLSSAQLAALGEDGIATFSTAEIAAIT
FT                   SKAVPGVSDDAITALSTAQIAALSTTAVASLTTAQVAALSTDQTAALSTAQLKALSSTQ
FT                   LAALSTDNVAALTTVQVAALGTKAVAGLTADQVEALSSDQVAALSTQQVAALGSEQLAV
FT                   LSAEDIAAFSTADIAAISSSAIAGLSADLMEALTTAQIVALSTKGVARLSTDQIDALSS
FT                   DQLAALSSVQVAVLSSAQLSALEAEDIATFSTADIAAIGSKAISGLSEDVVAALTSTQI
FT                   AALSTGGVAGLSTDQMATLSSDQVVALSTKQIAALKSTQVAALSTETVAALSSDLIAAL
FT                   STAGINELTTDQVEALSTDQIVALSTKQVAALSSAQIAALDTSDIAVFSTEQIAVLTTA
FT                   AISGLSTRQIDALSTEQMEALTAVQVGALSSAQLGALGTEDIAVFSTKDIAAISAAAMA
FT                   GLSTAVVAALSTDEIALLSTAGIAGLSSAQLNVLSTSQLAALSTKQAAALTSAQVAALG
FT                   TSGLAALSTDQISVLSAAAIAGLTTKQLVALGAGQMEALTSTQIGALSATQLGVLGAED
FT                   IAAFSTKDIAAIRSTAISSLSTAAIAALSTDQIAAVSAAGIAGLSSAQVNALSATQLAA
FT                   LSTKQVAALTSAQVTALGSSDITALSADQIEALGSAAVAGLTTRQLAALSTDQLEALTA
FT                   VQTGALSSVQLGALGAEDVAVFSTKDIAAIGSSAIAGLSTAAIASLSTEQIGALSAAAV
FT                   SALTTKQIAVLSSGQIAALSTEQLGGLTSQQIAALDADDIKALSIDDIAALGADLVSGL
FT                   STDVIAAFSTDQIAALSTAAVAALSTKQVDALSTGQLAVLTTAQIGALTSRQVDALSTD
FT                   DVATLTTDQIAALSAAGVVGLSTADIAILSSGQVDALTTSQIAALGSKQIAALGTDDIA
FT                   GFSVAEIAALSSSAVAGLSTETIAALSAEQIAALSTAGIAGLSTAQVNALSTDQIGALS
FT                   TEQVAALSSKQVAALGTDDMAALSADQIAALGTTGIAVLSSAQIDALSAEQLEALTSVQ
FT                   VAALSSTQIAALSTDDLAAFSTADIAAISSAAVAGLSTDTLAALSADQIAALSAAGIAD
FT                   LSTAQINALSADQLEALSTDQIAALSSKQVAALGTDDIAALSTEQIAALSTAGVAALST
FT                   AQIQALSADQLEALTPSQVAVMSSTQIAALSTADLESFSSADIGAIGSSAVAGLSTDTL
FT                   AALSADQIAALSATGVAGLSTVQILALSTDQIEALSTDQIAALSSKQLAVLGTDDIAVL
FT                   STDQIAALGTAAIAGLSTTQINALNADQLEAMTSGQVAVMSSTQIAALSTGDLESFSTA
FT                   DIAAISSRAVAGLSTDTIAALSADQIAALGTGGVAGLSTAQINALNTDQVEALTSLQIG
FT                   ALTSQQIAVLGTDDLETFSTDEIAAISSTAVLGLSTDTIAALSVDQVAALSSAGISGLS
FT                   TAQINALSTDQIEALSTAQIGGLGSKQVAALGTADLAVLSTSQIAALSTAGIAGLSSEQ
FT                   VGALSDEQVEALSTVQIAAMSSDALSGLSTDDLEGFSVEELAAISSSAIRGLSTDFIAG
FT                   LSTAEIAALGTASLAGLSSAQVGAMSAEQIDTLSTLQIAALSADGLAGLTTEDLGTFTT
FT                   GELVAISAAAIKGLSTTFVAALSTAEIAALTASQVGSLSYNQVAAMSTTQIATLSTAQL
FT                   SALNAIQAAALGTDDIAQLSTDDIVALGTSAISGLTTRVVAALTTDQAEALTAVQVGAM
FT                   TSAQVAALETEDLATFSAEDVASFSSYGVAGLSTEDIGNLSSTQLNALMDSQMDALDSD
FT                   QIAAVIAAYLGM"
FT   gene            complement(278903..279955)
FT                   /locus_tag="NGR_c02370"
FT   CDS_pept        complement(278903..279955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02370"
FT                   /product="predicted transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02370"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24035"
FT                   /db_xref="GOA:C3MFY4"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFY4"
FT                   /protein_id="ACP24035.1"
FT                   /translation="MRTALTETTAASGKTLSDKGVLRVGFILARSFTLSAFSLFADALR
FT                   LGSDVEDKSGRVNCDWEVLGSTRNFVMSSCGIQVAPTAPLRPPTEFSYIAVVGGRLNVA
FT                   EPLDRETVDYLHRATRAGVPIIGVCTGSFVLAEAGVLDGHAACVSWLHHNEFRARFPEI
FT                   EVTSNRIFFEDGNIITCAGGSSVADLATYLIRKHVGEDAERNALEIMQITRRREASEMQ
FT                   PRNPLGPVPVHDKRISLALMVMEQHLEDLIGIDDVATVLGISRRQLERLFQNELGATPI
FT                   SVYLKLRLDAAMRLVASTNKPLIEIALETGFENVSHFIRKFRKAFSITPAAARKQLAAA
FT                   ARDAAPGRRG"
FT   gene            280172..280360
FT                   /locus_tag="NGR_c02380"
FT   CDS_pept        280172..280360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02380"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24036"
FT                   /db_xref="GOA:C3MFY5"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFY5"
FT                   /protein_id="ACP24036.1"
FT                   /translation="MSMGEGVGTPVVGDGPSSCAFACSHLERGQGSGQMTMHMMKVLLS
FT                   LMAALSFGSFMVLVAVL"
FT   gene            complement(280398..280859)
FT                   /locus_tag="NGR_c02390"
FT   CDS_pept        complement(280398..280859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02390"
FT                   /product="conserved hypothetical protein, contains
FT                   YbaK/aminoacyl-tRNA synthetase associated region"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02390"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24037"
FT                   /db_xref="GOA:C3MFY6"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFY6"
FT                   /protein_id="ACP24037.1"
FT                   /translation="MSLTSVKEFFSKRAPDIDVIELEQSTATVALAAEGHGVEPAQIAK
FT                   TLALRVGDDVVLIVTRGDARLDNKKYKARFGTKARMLGSSEVETETGHPVGGVCPFGLV
FT                   KPHTVYCDESLKAFDVVVPAAGAINAAVHISPHRMAELTGAEWIDVSET"
FT   gene            complement(280944..281132)
FT                   /locus_tag="NGR_c02400"
FT   CDS_pept        complement(280944..281132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02400"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02400"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24038"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFY7"
FT                   /protein_id="ACP24038.1"
FT                   /translation="MSDFYAEKIETALQSYMSDHPATSTRQQAISTILENWFASHGYLP
FT                   PQQEGLRPEDLDASNDD"
FT   gene            complement(281304..281591)
FT                   /locus_tag="NGR_c02410"
FT   CDS_pept        complement(281304..281591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02410"
FT                   /product="hypothetical protein"
FT                   /note="similar to transglycosylase-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02410"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24039"
FT                   /db_xref="GOA:C3MFY8"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFY8"
FT                   /protein_id="ACP24039.1"
FT                   /translation="MFHGHNRKETLMGIESILVFLIVGAIAGWLAGLIVSGFGFGLIGN
FT                   IVVGIIGALIAGYLFPAVGITLGTGILAAIIHSTIGAIILLVLIRIVKQA"
FT   gene            complement(281815..283107)
FT                   /locus_tag="NGR_c02420"
FT   CDS_pept        complement(281815..283107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02420"
FT                   /product="L-rhamnose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02420"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24040"
FT                   /db_xref="GOA:C3MFY9"
FT                   /db_xref="InterPro:IPR013451"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFY9"
FT                   /protein_id="ACP24040.1"
FT                   /translation="MTNMISTSVIETENAKRQEALKSDYESLGERLARRGIDIDAVKRK
FT                   VAAYGVAVPSWGVGTGGTRFARFPGLGEPRNIFDKLEDCSVIQELTRATPTVSLHIPWD
FT                   KVSDLAGLRERGSALGLSFDAMNSNTFSDAPGQAHSYKFGSLTHNAAATRRQAVEHNLE
FT                   CIEIGKALGSKALTVWIGDGSNFPGQSSFTRSFERYLDSMKAIYAALPDDWRVFTEHKM
FT                   YEPAFYSTVVQDWGTNYLIAQELGPKAFCLVDLGHHAPNVNIEMIVARLIQFKKLGGFH
FT                   FNDSKYGDDDLDTGSIDPYRLFLVFNELVDAETRGADGFEPAHMLDQSHNVTDPIESLM
FT                   TSAMEVGRAYAQALLVDRNALEGHQQENDALMASETLKAAFRTDVEPILAVARLENGGA
FT                   IAPVATYRKSGYRPKVAAERPAIAGGGGGIV"
FT   gene            complement(283120..285219)
FT                   /locus_tag="NGR_c02430"
FT   CDS_pept        complement(283120..285219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02430"
FT                   /product="bifunctional rhamnulose-1-phosphate
FT                   aldolase/alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02430"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24041"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR013454"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFZ0"
FT                   /protein_id="ACP24041.1"
FT                   /translation="MLDKQQGARLANLWDDAKVARMSEAERLLYRSNLLGSDKRITNYG
FT                   GGNTSAKVMEKDPLTGEMAEVLWVKGSGGDVGTIKMDGFATLYMDKLRALKDIYRGVEF
FT                   EDEMVGYLPHCTFNLNPRAASIDTPLHAYVPKAHVDHMHPDAIIAIAASKNSKELTSKI
FT                   FGDEIGWLPWKRPGYELGLWLEKFCLENPKARGVVLESHGLFTWGDTAKEAYETTIEII
FT                   NRAIAWFEAENTAPAFGGEAKPALGAAERVAIVKKLMPVIRGLISTDEKKVGHFDDSKA
FT                   VLDFVTSTNLEPLAALGTSCPDHFLRTKIRPLVVDFDPAQPDIEKTLSGLPEAIAAYRA
FT                   DYARYYERCKRADSPAMRDPNAVVYLVRGVGMITFAKDKATARISGEFYVNAINVMRGA
FT                   SGVSTYVGLPEQEAFDIEYWLLEEAKLQRMPKPKSLAGRIALVTGGAGGIGKATAARLM
FT                   QEGACVVLADIDDAALEIAQSELAGRYGKDFVRSVSMNVTSEAAVEAGFGDALLAFGGL
FT                   DILVSNAGLASSAAIEDTTLALWNKNIDILATGYFLVSREAFRIFRNQKAGGNVVFVAS
FT                   KNGLAASPGASAYCTAKAAEIHLARCLALEGASAQIRVNVVNPDAVLRGSKIWSGEWKE
FT                   QRAAAYKMDVDELEAHYRERSMLKLSVFPEDIAEAIYFLASDMSAKSTGNIVNVDAGNA
FT                   QSFTR"
FT   gene            285421..286233
FT                   /locus_tag="NGR_c02440"
FT   CDS_pept        285421..286233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02440"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02440"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24042"
FT                   /db_xref="GOA:C3MFZ1"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFZ1"
FT                   /protein_id="ACP24042.1"
FT                   /translation="MHEKERHRIILSAVQEKPVVTVPELVELTGSSEATIRRDVAALHV
FT                   QKRLRRVRGGAEAINPPQFVGLAGRPFSVNEGLHAREKQAIAREAVALCQDGEPIIING
FT                   GTTTFQMVHFLANRRMQVFTNSFPIAEHLLKHSKNTVMLSGGTIYREQNIILSPFDNDV
FT                   TRNFYARRMFMGAQGLGPLGLMEADPLLIQAEQKLIDQADELVVLVDSSKFHKRSSLIL
FT                   CGLKRIATVITDSGIEDRHASMLESAGVTLVIANAKSKVDAETASTSA"
FT   gene            286363..287352
FT                   /locus_tag="NGR_c02450"
FT   CDS_pept        286363..287352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02450"
FT                   /product="rhamnose ABC transporter, periplasmic
FT                   rhamnose-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02450"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24043"
FT                   /db_xref="GOA:C3MFZ2"
FT                   /db_xref="InterPro:IPR013459"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR030159"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFZ2"
FT                   /protein_id="ACP24043.1"
FT                   /translation="MKILKSLMVTAAVAAALMANAAHAENKKIALVVKALGIGFFEAAN
FT                   KGAQEAAKELGDVEIIYTGPTSTTAEGQIEVINSLIAQKVDAIAVSANDTDALVPALKK
FT                   AMDRGIKVISWDSGVAKEGRLMHLNPSSSPLIGNMIIKLAADNLPEGGDVAVLSASATA
FT                   TNQNTWIAEMKKVQVNYKGINVVATVYGDDLADKSYRETQGLIQSHPNLKAIIAPTSIG
FT                   IVAAAQAVTDAGKIGQINVTGLGLPSEMAGHVKSGASKSFAIWNPIDLGYSATMIAYDI
FT                   INGAEAKPGAELKMGRMGTVKLDDNNEGAMADPFVYDASNVEEFAKIF"
FT   gene            287643..289154
FT                   /gene="rbsA2"
FT                   /locus_tag="NGR_c02460"
FT   CDS_pept        287643..289154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsA2"
FT                   /locus_tag="NGR_c02460"
FT                   /product="ribose import ATP-binding protein RbsA1"
FT                   /EC_number="3.6.3.17"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02460"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24044"
FT                   /db_xref="GOA:C3MFZ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015861"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFZ3"
FT                   /protein_id="ACP24044.1"
FT                   /translation="MKPAITLEGISKSFPGVRALSDVSLALYPGSVTALIGENGAGKST
FT                   LVKILTGIYQPDSGMIRVADTETTFPTALAAARAGVTAIHQETVLFDELSVAENIFLGH
FT                   APRNRFGLIDWKKLNADAAALLQRAGADFDPTIRLRDLGIAKKHLVAIARALSVDAQVV
FT                   IMDEPTAALSHKEIHELYALIERLKADGKAILFISHKFDEIFRIADRYTVFRDGTMVGE
FT                   GLIADASQDDLVRMMVGRAVDSVYPKKDVKIGEAVLTVSGYRHPTEFEDINFELRRGEI
FT                   LGFYGLVGAGRSEFMQSLIGITRPSAGAVRLDGNVLVIRNPAEAIRAGIVYVPEERGRQ
FT                   GAIIGMPIFQNVTLPSLSHTSRSGFLKLANEFALAREYTARLDLRAASLDQDVGTLSGG
FT                   NQQKVVIAKWLATKPKVIILDEPTKGIDIGSKAAVHAFMSELAAQGLSVIMVSSEIPEI
FT                   MGMSDRVIVMREGRIAGRFERSELTAEKLVRAAAGIETQINGRAA"
FT   gene            289151..290131
FT                   /locus_tag="NGR_c02470"
FT   CDS_pept        289151..290131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02470"
FT                   /product="predicted ABC transporter, inner-membrane
FT                   translocator"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02470"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24045"
FT                   /db_xref="GOA:C3MFZ4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFZ4"
FT                   /protein_id="ACP24045.1"
FT                   /translation="MIAKLLKNREILLVGAIAVLLALIALRFPGFVAPFNLARVYNDTS
FT                   ILIILALGQMAVILTRCIDLSMAANLALCGMVAAMLNAAFPGLPIPLIILAAMALGGLL
FT                   GMINGTLVWKLDIPPIVVTLGTLTIYRGLIFLLTDGKWINAHEMSDAFKALPRLDLAGM
FT                   PVLSWLSLLMIAVMFLVMSRTPIGRAFYAVGGHPHAAVYTGIDVGRTRFFAYCLSGTLA
FT                   GLSGYLWVSRYAVAYVDIAAGFELDIIAACVIGGISIAGGIGSVAGAVLGALFLGVIKN
FT                   ALPVINISPFAQMAISGTVIIIAVAVNARAERRKGRVILRKAEAV"
FT   gene            290131..291135
FT                   /locus_tag="NGR_c02480"
FT   CDS_pept        290131..291135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02480"
FT                   /product="predicted ABC transporter, inner-membrane
FT                   translocator"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02480"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24046"
FT                   /db_xref="GOA:C3MFZ5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFZ5"
FT                   /protein_id="ACP24046.1"
FT                   /translation="MAHAQLSPRNIPDRLEGRGARLLRSWEALLIVVATVIFLGNSFAS
FT                   PYFLDPWNLSDATFNFTEKAMIAFAMALVIISGEIDLSVASIIALASTAMGYAVQLGVD
FT                   TPVLVAIGLGVGLVCGAVNGLLITGLGLPSIVVTIGTMSLFRGLSFIILGDQAFTGYPE
FT                   SFAWFGQGYVWWVLSFEFTLFALLAVAYGVLLHKTNFGRAVYAIGNNQTAALFSGVRVA
FT                   RVKFTLFLLTGLMAGLASICLTSRLGSTRPSIALGWELEVVTMVVLGGVNILGGSGTIP
FT                   GVVLAALIMGMVTFGFGLLNVPGIVMSIFIGLLLISVIALPILWRRARRRLAH"
FT   gene            291145..291459
FT                   /locus_tag="NGR_c02490"
FT   CDS_pept        291145..291459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02490"
FT                   /product="putative L-rhamnose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02490"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24047"
FT                   /db_xref="GOA:C3MFZ6"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR013448"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MFZ6"
FT                   /protein_id="ACP24047.1"
FT                   /translation="MEKYAFRMRLNPGMAEEYRARHDAIWPELVTLLKEAGISDYSIHL
FT                   DEETGLLFGVLWRTENHTMADLPSHPVMQKWWAYMADIMETRADNEPVAVPLKTVFHLS
FT                   "
FT   gene            291461..292831
FT                   /locus_tag="NGR_c02500"
FT   CDS_pept        291461..292831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02500"
FT                   /product="predicted carbohydrate kinase contains FGGY
FT                   family domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02500"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24048"
FT                   /db_xref="GOA:C3MFZ7"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFZ7"
FT                   /protein_id="ACP24048.1"
FT                   /translation="MKTVAVIDIGKTNAKIALVDLEQFEEIAVRKTPNVVVKDGLYPHF
FT                   DVEYLWRFILDSLAALHRERPVDAISVTTHGATAVLLNDAGELAMPVLDYEYAGPDALS
FT                   EEYGQARPPFSETGSARLPMGLNVGAQLFWQQRMFPRDFAEVATILTYAQYWSYRLTGV
FT                   ATNELTSLGCHTDLWNPKTATFSTMVEARGWTPLFAPVRKADEVIGGLLPALAEATGLP
FT                   DRLPVYCGIHDSNASLLPHLLTRSAPFSVVSTGTWVVMMSVGGEQVELDERRDTLINVN
FT                   ALGDPVPSARFMGGRAFSLLIGDDPPPPSAEAERRVLAEGRMLLPSVPGGSGPFPSAEP
FT                   RWTVNEDNLTPAERLAAVSFHLSLMTATCLDLIGARGEIVVEGPFAANSAYLRMLAAAT
FT                   GRLVLANRLSSTGTSLGAACLVAGATIRTGAEAFSEAVPRSYVDYAHKWQRLTAEHV"
FT   gene            293522..295135
FT                   /locus_tag="NGR_c02510"
FT   CDS_pept        293522..295135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02510"
FT                   /product="predicted chemotaxis methyl-accepting receptor
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02510"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24049"
FT                   /db_xref="GOA:C3MFZ8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFZ8"
FT                   /protein_id="ACP24049.1"
FT                   /translation="MQQEASEQARKGQAGSLLERLRFAGLDERACALLRDHRQVLSPSI
FT                   ELALRDLFQRLQANPDAVRHFDSDRQLDRLHDLQSSHWNVLTDARFDGLYAERVKVLAD
FT                   TEARMGLDPRWQLASHAVVLEHLIVGAIENAWPKSLLPFGKARRSELCRLVAALVRAAF
FT                   VDGEIAVSLRFNALRQQHQRHLSDQRKGDESEVAALFSDFLQALGTGDLGARLPTDAPD
FT                   AYRPIAAGLNAALDQIQNALLSGDKRAAAAETIVESLRGRTSEFSGSASGEAEALTGQV
FT                   AALGAMTERMRSGSIRISETETRASETRQAAERSGEIAGQAISAMADIEASAEKIGQII
FT                   GVIDEIAFQTNLLALNAGIEAARAGESGRGFAVVAQEVRALAQRSGEAAREIKQLVNGT
FT                   KTQVEAGVEIVGQTQNAISSIVDQVISINAAVSGIAREAETQVNDLAAAASEIGGISKA
FT                   MARSATLAGEAAASTEDLHGTILELGQTIRRFRFERQAGLRASTIAPPPALLPQVDGDE
FT                   AAMPFSDDTALGRHVAGWRR"
FT   gene            295165..295458
FT                   /locus_tag="NGR_c02520"
FT   CDS_pept        295165..295458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02520"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24050"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFZ9"
FT                   /protein_id="ACP24050.1"
FT                   /translation="MASKNTAKKSLKLAPVLDLNEATALHERLLSLKGSPVAIDASAVE
FT                   RIGTLCAQVLMAGARSWEEDRVSFTFAKVSDAFVKTTQLIGVDIAPLMAKEI"
FT   gene            295462..295827
FT                   /locus_tag="NGR_c02530"
FT   CDS_pept        295462..295827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02530"
FT                   /product="putative two-component response regulator
FT                   receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02530"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24051"
FT                   /db_xref="GOA:C3MG00"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG00"
FT                   /protein_id="ACP24051.1"
FT                   /translation="MKKRVLTVDDSRTIRNMLLVTLNNAGFETIQAEDGVEGLEVLETA
FT                   NPDVIVTDINMPRLDGFGFIEGVRRNDRYRAVPILVLTTESDAEKKNRARQAGATGWIV
FT                   KPFDPTKLIDAIERVTA"
FT   gene            295847..298141
FT                   /gene="cheA2"
FT                   /locus_tag="NGR_c02540"
FT   CDS_pept        295847..298141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA2"
FT                   /locus_tag="NGR_c02540"
FT                   /product="Chemotaxis protein CheA"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02540"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24052"
FT                   /db_xref="GOA:C3MG01"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG01"
FT                   /protein_id="ACP24052.1"
FT                   /translation="MDMNEIKEIFFQECEEQLAELESGLLRLNDGDRDPETVNAVFRAV
FT                   HSIKGGAGAFGLDDLVSFAHVFETTLDCVRSNRLEPNQDVLKVMLKSADVLADLTNAAR
FT                   DGGSVDEARSRQLIKELEALANGELPQAAVSEPAAKPAPPAAPVPAPAPAPVVNDEGFQ
FT                   PVAFSFDDFEASEPPAIEPSTFEILFRPKSELYAKGNDATLLLRDLSRLGEMSIHCDMD
FT                   ELPALGSMNPEAAYFAWKISLKTDKGEEAIRSVFEFAEWDCELDVALAGGNAGAGEELP
FT                   MQPVPFDLSLLDGDVSASSGAAEDDEQVVAQREARDEAVSAAATASNVLQMAQTARASA
FT                   ESAKSASPASAAQAAAQQAASAATPTIRVDLDRVDRLINLVGELVINQAMLSQSVIEND
FT                   TNGTSSINMGLEELQQLTREIQDSVMAIRAQPVKPVFQRMSRIVREIADMTGKSVRLVT
FT                   EGENTEVDKTVIDKLAEPLTHMIRNAVDHGLETPEKRVAAGKNPEGTVRLTAKHRSGRI
FT                   VIELADDGAGINREKVRQKAIDNDLIAADANLSDEEIDNLIFHAGFSTADKISDISGRG
FT                   VGMDVVKRSIQALGGRINISSKPGQGSVFTMSLPLTLAVLDGMVVTVANQTLVVPLTAI
FT                   VETLQPEASAIHSFGASQRLISIRNSFCPLVDVGRILNFRAIQANPVDGVALLVESEGG
FT                   GQRALMVDAIQGQRQVVIKSLEANYTHVPGIAAATILGDGRVALILDVDAIVAASRGQT
FT                   LKPEMSLAAAG"
FT   gene            298146..298613
FT                   /gene="cheW1"
FT                   /locus_tag="NGR_c02550"
FT   CDS_pept        298146..298613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW1"
FT                   /locus_tag="NGR_c02550"
FT                   /product="putative CheW family chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02550"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24053"
FT                   /db_xref="GOA:C3MG02"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG02"
FT                   /protein_id="ACP24053.1"
FT                   /translation="MTYVAKNLTTGGRELIAFRVGGQEFCVNIMSVREIRGWTPAIAMP
FT                   HAPSYMLGIVNLRGAVLPIIDFSARLGMKAAEPTVRHVIIVAQVKSQVVGLLVDAVSDI
FT                   LTVSDGDIQPTPDIASDFERSFARGVLAIEGRMICLVELDQVFPHEEREAA"
FT   gene            298610..299518
FT                   /gene="cheR"
FT                   /locus_tag="NGR_c02560"
FT   CDS_pept        298610..299518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR"
FT                   /locus_tag="NGR_c02560"
FT                   /product="Chemotaxis protein methyltransferase, CheR-type"
FT                   /EC_number="2.1.1.80"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02560"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24054"
FT                   /db_xref="GOA:C3MG03"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG03"
FT                   /protein_id="ACP24054.1"
FT                   /translation="MRAQATFEQKLSPDECLAAGEYPLTRRDLGEIAAMIYADAGIYLN
FT                   ESKASLVYSRLSKHIRNLGLKGFRDYCQLVASPAGAAARRDMLSHLTTNFTRFFRENHH
FT                   FEHLKTDVLPGLIARAKNGGRVRIWSAACSDGQEPYSIALTVLSLLPNAADYDFRILAT
FT                   DIDPKILALARAGAYDATALETVSPAMRKQWFREVDVNGRGKWQVDDRVKRLITFNELN
FT                   LMAQWPLKGPFDVIFCRNVVIYFDEPTQMKIWSRFAGVLDTGGHLYIGHSERVSGDAKA
FT                   IFDNIGVTTYRHTGKFHGGRA"
FT   gene            299515..300567
FT                   /gene="cheB2"
FT                   /locus_tag="NGR_c02570"
FT   CDS_pept        299515..300567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheB2"
FT                   /locus_tag="NGR_c02570"
FT                   /product="Chemotaxis response regulator protein-glutamate
FT                   methylesterase CheB"
FT                   /EC_number="3.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02570"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24055"
FT                   /db_xref="GOA:C3MG04"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG04"
FT                   /protein_id="ACP24055.1"
FT                   /translation="MNAPARVLVVDDSPTMRGLISAVLNADPEVKVVGQAADALEARQA
FT                   IKQLDPDVVTLDIEMPNMNGLEFLDKIMRLRPMPVIMVSTLTHKGAEATIAALEIGAFD
FT                   CVGKPHPGDPNPFGGLVDKVKAAARSQRKSMITSNRAASAPAVATASDYRAGRKIIAIG
FT                   ASTGGVEALIAVLQKFPANCPPTVITQHMPHTFTKSFSERLNRLCAPTVEEATDGARLE
FT                   VGKVYLAPGGDRHLQIANASAPCCRLVDREPVNGHRPSVDVLFDSVAELAGRNAIGVIL
FT                   TGMGRDGAAGLLKMRHAGARTFGQNEKTCVVYGMPRVAHELGAVEMQLPLGSIGEEILK
FT                   SAAARKEGNE"
FT   gene            300567..300956
FT                   /locus_tag="NGR_c02580"
FT   CDS_pept        300567..300956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02580"
FT                   /product="predicted signal transduction response regulator,
FT                   contains receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02580"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24056"
FT                   /db_xref="GOA:C3MG05"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG05"
FT                   /protein_id="ACP24056.1"
FT                   /translation="MSIAEKIKVLIVDDQVTSRLLLGDALQQLGFKQITAAGDGEQGMK
FT                   IMAQNPHHLVISDFNMPKMDGLGLLQAVRSNPNTKKAAFIILTAQGDRALVQKAAALGA
FT                   NNVLAKPFTIEKMKAAIEAVFGALK"
FT   gene            300953..301507
FT                   /gene="cheD"
FT                   /locus_tag="NGR_c02590"
FT   CDS_pept        300953..301507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheD"
FT                   /locus_tag="NGR_c02590"
FT                   /product="predicted chemotaxis protein CheD"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02590"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24057"
FT                   /db_xref="GOA:C3MG06"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MG06"
FT                   /protein_id="ACP24057.1"
FT                   /translation="MMLEAAGRRVHVIQGEFKVVNDPDVVLSTILGSCVAACMRDPVSG
FT                   VGGMNHFLLPGSSTSPASAGDATRYGVHLMELLINGLLKQGARRDRLEAKIFGGAKTIA
FT                   RFSNVGEQNAAFARQFLLDEGIRVVGESTGGEHGRKLEYWPVTGRARQYALTGVEAQRA
FT                   IHQDQRPAPAPKPVESSIEFF"
FT   gene            301571..301957
FT                   /locus_tag="NGR_c02600"
FT   CDS_pept        301571..301957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02600"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24058"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG07"
FT                   /protein_id="ACP24058.1"
FT                   /translation="MQTDHQSYMPHAEESLPEVLMRIVTELHDVAYLIERIEPQLWNGH
FT                   DGSATEDKMMVLQGIDLAVQKTRGLAEFIDTITASIPDTCLVDISTAVNLVKLADMKKA
FT                   LGNGLLRHGHSQPLTKASGDFEAF"
FT   gene            302190..303869
FT                   /gene="fliF"
FT                   /locus_tag="NGR_c02610"
FT   CDS_pept        302190..303869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="NGR_c02610"
FT                   /product="flagellar M-ring protein FliF"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02610"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24059"
FT                   /db_xref="GOA:C3MG08"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG08"
FT                   /protein_id="ACP24059.1"
FT                   /translation="MNLFDQFSTFTKNLSNLGQSKLIALAVAGIVAIGFVLGAAIYVNK
FT                   PAYETLYVGLERSDVTQISIALAEANLDFEVGSDGGSIQVPVGMTGKARLLLAERGLPS
FT                   SANAGYELFDNVGSLGLTSFMQEVTRVRALEGEIARTIQQISGIAAARVHIVMPERGSF
FT                   RKAEQTPTASVMIRASATVGRGAASSIRHLVASSVPGLDIDDVTILDSTGQLLASGDDP
FT                   ANSALNQSLGVVQNVQTDLEKKIDNALAPFLGMDNFRTSVTASLNTDAQQIQETVFDPE
FT                   SRVERSTRVIKEEQKSSQQQPDNAATVQQNVPQAAPRGGAGQQSNDEAAKKEEQTNYEI
FT                   NSKTIATVKNSYSIERLSIAVVVNRGRLAAMVGEGADQAKIDAYLQDMQKIVASAAGVD
FT                   TNRGDVVTLNAMDFVETQLLDQAVAGPGVMEMLTRNLGGIINSLAFILVAFLVVWLGMR
FT                   PLARQMGFGGQSGHLEGEGAGLELPDFSPAGASAAGGALMEGFGSDFGFDSTDDLLNIS
FT                   DEGNGFNRRVKEGPERRLARMVEISEERAAKILRKWSLDRAA"
FT   gene            304723..305460
FT                   /locus_tag="NGR_c02620"
FT   CDS_pept        304723..305460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02620"
FT                   /product="predicted LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02620"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24060"
FT                   /db_xref="GOA:C3MG09"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG09"
FT                   /protein_id="ACP24060.1"
FT                   /translation="MEISTTGAAWSLQTAAPRVSSRGISREQLIRRLGEAAERSSLANG
FT                   LAILTEYVGATHHLLARHDLSQDGGLDFVLCSDWPFDVVRRLASIVIGLNAKTTELEKC
FT                   LAALQPCFQVLPDDIDLPRGVNRSYCSVTFNVGRSRFSLMLLFPEDVILSQEGLRDIAV
FT                   LASYLASFKAGAGVRHDRDFELTEREIECLFWIAEGKTSEEIAVILGISRNTINNYITS
FT                   VMRKTATRTRSEAIAHAVRHNLV"
FT   gene            305471..306211
FT                   /locus_tag="NGR_c02630"
FT   CDS_pept        305471..306211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02630"
FT                   /product="predicted LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02630"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24061"
FT                   /db_xref="GOA:C3MG10"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG10"
FT                   /protein_id="ACP24061.1"
FT                   /translation="MMHLDPEGRVDDARLGRSARAARAATLVTRLQAMQRQVNAKNFAV
FT                   LRVNGRGMPATRKLTCVLHNWGAASETNAHELLKVYGEELLQHLDRSPLAVLWDGQGEH
FT                   QAADAPDMALFSNRLKGRKLSYSGIAFPIRLGAQGNGYVVFAGSYIDAPAEQVLDLHGR
FT                   CAQVMADMLAADERRLFKGESLSDREIACLQMAGDGYISEEIAEKMGLSVHTVNAYLGA
FT                   ATTKLDSVNRIQAIAKAIRLGYIS"
FT   gene            complement(306382..306822)
FT                   /locus_tag="NGR_c02640"
FT   CDS_pept        complement(306382..306822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02640"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24062"
FT                   /db_xref="InterPro:IPR017024"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG11"
FT                   /protein_id="ACP24062.1"
FT                   /translation="MKKCEFSEKREKLVAEAIRPVATELRLIDAADFIALLRFESHASL
FT                   ADLVESAAELYFLPGTVNFGLGGNYNLDWNSRPEIILDLELKPRGVTVYARLVLAGEAA
FT                   GIEISHINFQHPSTDPDENTAFLARSLEEAKFVKSYPLPLAS"
FT   gene            complement(306825..307907)
FT                   /gene="flhB"
FT                   /locus_tag="NGR_c02650"
FT   CDS_pept        complement(306825..307907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="NGR_c02650"
FT                   /product="flagellar biosynthetic protein FlhB"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02650"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24063"
FT                   /db_xref="GOA:C3MG12"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG12"
FT                   /protein_id="ACP24063.1"
FT                   /translation="MSDDQDKDSKTEAPSEKKLSDAAEKGNVPFSREVTAFASTLAVYI
FT                   FIVFFLSDGAASTAEALKDIFEQPEAWRLETATDAVGLISHVVLKSAGLVLPVFVLLII
FT                   FGVGSSIFQNLPRPVLDRIMPNMNRVSPIAGFKRIFGVPGLVEFAKSLFKIIVVSIIVV
FT                   LVLWNDYFATLDLMFSDPVTIFATMISDLKQIVTVVLLATAVLAIVDLFWTRHHWYSEL
FT                   KMTKQEVKEELKQSQGDPIVKSRLRSMQRDRARKRMIASVPRATLVIANPTHYAVALRY
FT                   VREESDAPVVVAMGQDLVALKIREIAEKNGIPVFEDPPLARSMFAQVSVDSVIPPVFYK
FT                   AVAELIHRVYAAQPQQKRVT"
FT   gene            complement(308092..309123)
FT                   /gene="fliG"
FT                   /locus_tag="NGR_c02660"
FT   CDS_pept        complement(308092..309123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="NGR_c02660"
FT                   /product="flagellar motor switch protein FliG"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02660"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24064"
FT                   /db_xref="GOA:C3MG13"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG13"
FT                   /protein_id="ACP24064.1"
FT                   /translation="MMDFDGFEAQALATPLSQTEKAAAVLLAMGKSVAGKLLKFFTQSE
FT                   LQAIIAAAQSLRAIPPHELEALVNEFEDLFTEGAGLMDNAKAMESILEEGLTPDEVDGL
FT                   LGRRATFQSYEASIWDRLQECDPAAVAQSLAEEHPQTIAYVLSMMPSSFGAKVLLQLSD
FT                   RLRPDILNRAVNMKSVSPRAASIIEARVIEMIEEMEAERNSPGPAKIAEVMNELEKKQV
FT                   DTLLASLETISTDSAKKVRPKIFLFDDILYMPQRSRVQLFNDVSTDVITMALRGSGPEL
FT                   RESVLASVGARQRRIIESDLAVGDAGINPRDIAIARRSITQEAIRLAASGQLELKEKES
FT                   EAA"
FT   gene            complement(309152..309784)
FT                   /gene="fliN"
FT                   /locus_tag="NGR_c02670"
FT   CDS_pept        complement(309152..309784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="NGR_c02670"
FT                   /product="predicted flagellar motor switch protein FliN"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02670"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24065"
FT                   /db_xref="GOA:C3MG14"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG14"
FT                   /protein_id="ACP24065.1"
FT                   /translation="MPEASFNWNNPHMVRKKAASIEEQAAFAGDAELDQAIDDLRGVLK
FT                   QDGAATDFGAEFGAAEPFGQGADFGGGLGAGGFGGDFADTSLDGGLDVGTGFAGSDFGG
FT                   SDFGGGDFGAVSSGIETAPGSGMAANMDLIMDIPIDVQIVLGTSRMQVSGLMGLTEGAT
FT                   IALDRKIGEPVEIMVNGRVIGRGEITVLEGDVTRFGVKLIEIKGSRK"
FT   gene            complement(309804..310751)
FT                   /gene="fliM"
FT                   /locus_tag="NGR_c02680"
FT   CDS_pept        complement(309804..310751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="NGR_c02680"
FT                   /product="Flagellar motor switch protein FliM"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02680"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24066"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG15"
FT                   /protein_id="ACP24066.1"
FT                   /translation="MNPSTDSNVYAFDKKLLARMTGALGDDKTIGRTALELGHVFSERL
FT                   PEMLKQETGRDIAIGYAGVKMGFRNELIADLGEAVLLSDVSLRNWCAEFQIGCDSPVLI
FT                   ALVEALLGAEPIDIEEPLPRALSKIEIDVAVPVFERIAEAVRMAVDAPGGFEPVVGRPH
FT                   NGAERLPPDPALEDVYAASIDMTFGLGPVLSTFSVIIPQNVLLKTQIVPPGNAGRNESM
FT                   KTDWSEQLEEQIRRSAVTLEARIQLESLTLDTISRLQPGDVIPFHDGQDVRVEVNANGR
FT                   DLYVCEFGRSGSRYTVRVKDTHGSEQDILRHIMS"
FT   gene            complement(310756..311634)
FT                   /gene="motA"
FT                   /locus_tag="NGR_c02690"
FT   CDS_pept        complement(310756..311634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="NGR_c02690"
FT                   /product="chemotaxis protein motility protein A"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02690"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24067"
FT                   /db_xref="GOA:C3MG16"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG16"
FT                   /protein_id="ACP24067.1"
FT                   /translation="MNIIIGLLVTFGCILGGYLAMGGHLEVLNQPFELMIIGGAGIGGF
FT                   IMANSMKVVKDTGKALGEAFKHKVPKERHYLDTLGVLYSLMRDLRTKSRNEIESHIDNP
FT                   EESPIFQSAPTVLQNKELTAFICDYVRLIIIGNARSHEIEALMDEEIHTITHDKMKCYH
FT                   ALTSMGDALPAIGIVAAVLGVIKAMGAISEAPEVLGAKIAAALVGTLLGVFLSYSIVGP
FT                   LVANIKAVREKQNRLYVIVKQTLLAYMNGSVPQVALEYGRKTISAYERPSIDAVEQEMM
FT                   NPGGGGESKAA"
FT   gene            311691..312596
FT                   /locus_tag="NGR_c02700"
FT   CDS_pept        311691..312596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02700"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24068"
FT                   /db_xref="InterPro:IPR010626"
FT                   /db_xref="InterPro:IPR023157"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG17"
FT                   /protein_id="ACP24068.1"
FT                   /translation="MRLAANPARHRRAEQVRASQYGQDLSRSGHRAGPLLRTGRPIVTT
FT                   TYTSYKLITADITGSLERVSEQPVVARETEYYLSRIGSIKSLDEFFADSRLYDYAMKAH
FT                   GLEDMAYAKAFMRKVLTEGIDSEDAFANKLADSRYKALVESLNFARHGDTATSFERAQK
FT                   GVVDKYARQTLEQNAGEENGGVRLALYFERMAPLITSGYEIIADEALAQVVRAALQLPE
FT                   EFAAADVDRQAEAYEEAIDLKDFQDPVKLAAFIDRFTALWEIENSSDSYDPLAVFGSSS
FT                   GYGISPDLLLSINNLKLGGR"
FT   gene            312598..313323
FT                   /gene="flgF"
FT                   /locus_tag="NGR_c02710"
FT   CDS_pept        312598..313323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgF"
FT                   /locus_tag="NGR_c02710"
FT                   /product="Flagellar basal-body rod protein FlgF"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02710"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24069"
FT                   /db_xref="GOA:C3MG18"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG18"
FT                   /protein_id="ACP24069.1"
FT                   /translation="MQTGLYVALSSQMALEKRLNTLADNIANANTVGFRSTEVKFDQVL
FT                   GDTKPSKVSYVSEGEEYLNTGNGALARTGSALDFAIKGNAWFNIDTPGGPALTRDGRFT
FT                   LTETGELVTLKGYPVLDAGGAPIQLNGGAGEITVGADGAIHQNGVQVALLGLYEADFSS
FT                   GFVRYDNSAVMPAAQPEPVVDRFDVGVMQGFLEESNVNAVQEMTQLIMVTRAFDNVTAL
FT                   MRDSEGSLEEAIKTLGGER"
FT   gene            313488..314888
FT                   /gene="fliI"
FT                   /locus_tag="NGR_c02720"
FT   CDS_pept        313488..314888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="NGR_c02720"
FT                   /product="flagellum-specific ATP synthase"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02720"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24070"
FT                   /db_xref="GOA:C3MG19"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022426"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG19"
FT                   /protein_id="ACP24070.1"
FT                   /translation="MEPQGSDTIPASTSLAALAGLVERYANPDVSIAPGGHVQTISPGH
FT                   YTVSGLSRHVRLGDFVAHKSATGTHLGEVVRVEPDRVVVCPIEPGDPIGIHDTVIRKGA
FT                   FRIAPTDNWCGRTINALAEPIDGRGPLMQGDMRRSISNTAPPSMTRRRVEQGFKTGVRA
FT                   VDIFSPLCLGQRLGIFAGSGVGKSTLLSMLARADAFDKVVIALVGERGREVREFIEDTL
FT                   GDNLAKSVAVVATSDESPMLRKMAPLTAVTIAEHYRDKGDNVLLIVDSVTRFAHAIREV
FT                   ATAAGEPPIARGYPASVFTELPRLLERAGPGAEGTGTITAIISILVDGDNHNDPVADSA
FT                   RGILDGHIVLDRSLAEEGRYPPIDPLASISRLARKAWTPDQEKLVARLKSLIHRFEETR
FT                   DLRLIGGYRAGGDPDLDMAIKQVPVIYDVLKQTPGERSVADAFTDLANALKAAAMGNAP
FT                   AAAIRGKG"
FT   gene            314891..315442
FT                   /locus_tag="NGR_c02730"
FT   CDS_pept        314891..315442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02730"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24071"
FT                   /db_xref="GOA:C3MG20"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG20"
FT                   /protein_id="ACP24071.1"
FT                   /translation="MTDNEADEIVHQRRRDAKMPLTDKVLGAIGLAMAAFATFFPWYAF
FT                   LHQDQFSIPPLWRGTTRDLPERPGRGVVSVSPLAMTDVDAETAAAIDRLTTATVPGLEH
FT                   QPAAGAGEPQAGPEQPFPEPSGFKLMHVANGRALIEDATGMYIVRIGSVLPDNSRLATF
FT                   EERNGRWVMITSKGQVYQAN"
FT   gene            315625..316005
FT                   /gene="flgB"
FT                   /locus_tag="NGR_c02740"
FT   CDS_pept        315625..316005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="NGR_c02740"
FT                   /product="putative flagellar basal-body rod protein FlgB"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02740"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24072"
FT                   /db_xref="GOA:C3MG21"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG21"
FT                   /protein_id="ACP24072.1"
FT                   /translation="MDPIQLFELASRQAQWLTVRQNVVAGNIANANTPHYRAKDVQPFE
FT                   SVLQNTGVQMAATHRAHFTESPDAAQVTDVGMIDDVAVQQSGNTVALEQEMMKTGEIKR
FT                   DYELNSGLVKSFHRMMLMTVRK"
FT   gene            316011..316430
FT                   /gene="flgC"
FT                   /locus_tag="NGR_c02750"
FT   CDS_pept        316011..316430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="NGR_c02750"
FT                   /product="flagellar basal-body rod protein FlgC"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02750"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24073"
FT                   /db_xref="GOA:C3MG22"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG22"
FT                   /protein_id="ACP24073.1"
FT                   /translation="MDPLTSALKVSASGLQAESTRLRIVSENIANARSTGDVPGADPYR
FT                   RKTISFAAEVDRASGASLVEVQRLGTDDSDFSIEFDPGNPAADEKGMVKMPNVNVLIEM
FT                   ADMREANRAYEANLQTVKQSRDLISQTIDLLRASQ"
FT   gene            316430..316765
FT                   /gene="fliE"
FT                   /locus_tag="NGR_c02760"
FT   CDS_pept        316430..316765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="NGR_c02760"
FT                   /product="predicted flagellar hook-basal body complex
FT                   protein FliE"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02760"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24074"
FT                   /db_xref="GOA:C3MG23"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MG23"
FT                   /protein_id="ACP24074.1"
FT                   /translation="MIDAIQSVGAFSNLKEAEGTSLTASTALSLPSAGASAPQSQSFAE
FT                   VLGTMTTDAIRSMKSAEGVSLQAIRGEANTREVVDAVMNAEQSLQTALAIRDKVVTAYL
FT                   EIARMQI"
FT   gene            316777..317565
FT                   /gene="flgG"
FT                   /locus_tag="NGR_c02770"
FT   CDS_pept        316777..317565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="NGR_c02770"
FT                   /product="flagellar basal-body rod protein FlgG"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02770"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24075"
FT                   /db_xref="GOA:C3MG24"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG24"
FT                   /protein_id="ACP24075.1"
FT                   /translation="MKALSIAATGMNAQQLNLEVIANNIANINTTGYKRARAEFSDLLY
FT                   QTERAQGVPNRSNQAIVPEGAIVGLGVQTAAVRNLHVQGSLVNTSNDLDLALVGRGWFQ
FT                   VETPNGETVYTRSGAFNTNATGQLVTIDGYTVVPGITVPQDATEITVSASGQVLVRIGD
FT                   ATETQEIGQLTIANFVNEAGLEPQGENLFKQTAASGEPIVGTPADPGFAQIKQGYLESS
FT                   NVDPVKEITDLISAQRAYEMNSKVIQAADEMAATVSKNLR"
FT   gene            317584..318093
FT                   /locus_tag="NGR_c02780"
FT   CDS_pept        317584..318093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02780"
FT                   /product="SAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02780"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24076"
FT                   /db_xref="GOA:C3MG25"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG25"
FT                   /protein_id="ACP24076.1"
FT                   /translation="MMFRRSAERAAIEGRFARLTRPLAFAAIAAALLSPALVSAQQPTA
FT                   VIPKQIIYPGETIEASMLEVVDVTNPDLADGYIGSLEEVEGKVTKRTLLPGRVILASAL
FT                   RDRYAVERGSTVRLIFNNGGLTITAAGSPLEDAAVGELIRARNIDSGVIVSGTVMADGT
FT                   VHVVAK"
FT   gene            318090..319205
FT                   /locus_tag="NGR_c02790"
FT   CDS_pept        318090..319205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02790"
FT                   /product="flagellar P-ring protein precursor"
FT                   /note="basal body P-ring protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02790"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24077"
FT                   /db_xref="GOA:C3MG26"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MG26"
FT                   /protein_id="ACP24077.1"
FT                   /translation="MTMRVCKWLLTFALLFAATLTPAHSASRIKDVASLQAGRDNQLIG
FT                   YGLVVGLQGTGDSLRSSPFTDQSIRAMLQNLGISTQGGESRTRNVAAVLVTATLPPFAS
FT                   PGSRVDVTVGSLGDATSLRGGTLVMTSLSGADGQIYAVAQGSIVVTGFSAQGDAASLSQ
FT                   GVTTAGRVPNGAIIERELPSKFKDGFNLVLQLRNPDFSTAVGMAAAINKFASAQFGGRI
FT                   AEALDSQSVLVQKPKMADLARLMADIENLVVETDVPARVVVNERTGTIVIGQDVRVNEV
FT                   AVSYGTLTVQVTETPTVVQPAPFSRGETAVEPNTTIEAQSDGGTVAILNGSSLRSLVAG
FT                   LNSIGVKPDGIIAILQSIKTAGALQAELVLQ"
FT   gene            319202..319741
FT                   /locus_tag="NGR_c02800"
FT   CDS_pept        319202..319741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02800"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24078"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG27"
FT                   /protein_id="ACP24078.1"
FT                   /translation="MTGTMDLLPGKSRRTLLAAAGGALMLVMPGAFAQDVTAPPAENGA
FT                   TNEIQQFCTNIADAARDQRYLLQRKDLETLQASVDERIATLEKRRAEYEDWLKRRNDFL
FT                   KQAELGLVDIYKTMKPDAAAGKLEMVRPEIAAAIVMKLPARQSSLILSEMSDEKAAVLT
FT                   NIISSASDPNTSKEPS"
FT   gene            319738..320448
FT                   /gene="flgH"
FT                   /locus_tag="NGR_c02810"
FT   CDS_pept        319738..320448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /locus_tag="NGR_c02810"
FT                   /product="flagellar L-ring protein precursor (basal body
FT                   L-ring protein) FlgH"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02810"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24079"
FT                   /db_xref="GOA:C3MG28"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MG28"
FT                   /protein_id="ACP24079.1"
FT                   /translation="MRMQLTAVLAASLLAGCQNQAFREIGQAPSMSPIGSGLQYTQAPQ
FT                   LAAYPKQPHQMTAGYSLWNDQQAALFKDARAINVGDILTVDIQIDDKASFNNETDRSRT
FT                   NSSGFNLGASGESQTSDFEWSGNLKYGSNIKTEGDGKTERSEKLRLLVAAVVTGVLENG
FT                   NLLISGSQEVRVNHELRILNVAGIVRPRDVDADNIISYDRIAEARISYGGRGRLMEVQQ
FT                   PPWGQQVVDLVSPI"
FT   gene            320460..320951
FT                   /gene="fliL"
FT                   /locus_tag="NGR_c02820"
FT   CDS_pept        320460..320951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliL"
FT                   /locus_tag="NGR_c02820"
FT                   /product="putative flagellar basal body-associated protein
FT                   FliL"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02820"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24080"
FT                   /db_xref="GOA:C3MG29"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG29"
FT                   /protein_id="ACP24080.1"
FT                   /translation="MEEIDIKQQKSPSLVMTIAAVAVLTLVAGGGGWLVGIFLAPPPAE
FT                   KAEAVAEVPENATGEEGLPKIATEANGIVQLEPITTNLAYPAENWVRVEVALQFKGVPD
FT                   VALAEEIHQDIIAYLKTVSLQQIQGPRGFQYLRDDIQERVDLRSDGRVTNVMFRTFVIQ
FT                   "
FT   gene            321007..321744
FT                   /gene="fliP"
FT                   /locus_tag="NGR_c02830"
FT   CDS_pept        321007..321744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="NGR_c02830"
FT                   /product="flagellar biosynthetic protein FliP"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02830"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24081"
FT                   /db_xref="GOA:C3MG30"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG30"
FT                   /protein_id="ACP24081.1"
FT                   /translation="MLRIAAFIVAMMAMSGIAGAQSFPADILNTPVDGSVASWIIRTFG
FT                   LLTVLSVAPGILIMVTSFPRFVIAFAILRSGMGLATTPSNMIMVSLALFMTFYVMAPTF
FT                   DRAWREGIDPLLKNEISETEALPRVSEPFREFMLANTRDKDLQLFIDIAREKGQTVVVD
FT                   DKVDLRAVVPAFMISEIRRGFEIGFLIMLPFLVIDLIVSTITMAMGMMMLPPTSISLPF
FT                   KILFFVLIDGWNLLVGSLVRSFT"
FT   gene            322029..322937
FT                   /locus_tag="NGR_c02840"
FT   CDS_pept        322029..322937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02840"
FT                   /product="flagellin C protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02840"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24082"
FT                   /db_xref="GOA:C3MG31"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG31"
FT                   /protein_id="ACP24082.1"
FT                   /translation="MASILTNSSATAALQTLRSISSSMEDTQNRISTGMRVGSASDNAA
FT                   YWSIATTMRSDNAALSSVTDALGMGAAKVDTAYAGMEAAIDVVKEIKAKIVAATEEGVD
FT                   GAKVQEEIDQLQDQLLSIAESASFNGENWIAGEAATKTVVTGFVRASDGTVSIKTSSYT
FT                   LTDAADGTLLFADDGAGGLDTATGILGTAGTNGNDVYGLDISAMDATALGEALSDVEDA
FT                   LTAMTSAASSLGSMSTRIDLQADFVSELSDSIENGIGRLVDADMNEESTRLKALQTQQQ
FT                   LAIQALSIANSDSQNILSLFR"
FT   gene            323185..324105
FT                   /locus_tag="NGR_c02850"
FT   CDS_pept        323185..324105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02850"
FT                   /product="putative flagellin B"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02850"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24083"
FT                   /db_xref="GOA:C3MG32"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG32"
FT                   /protein_id="ACP24083.1"
FT                   /translation="MTSILTNIAAMSALETLRSIGSNMETTQGRVSSGLRVGEASDNAA
FT                   YWSIATTMRSDNMALSAVQDALGLGAAKVDTAYAGMESAIEVVKEIKAKVVTATEEGVD
FT                   KAKVQEEIDQLQEQLLSIAESASFSGENWIGGVAGNTVTVVSGFVRASDSTVSVKTTSY
FT                   ALVDGVTGGNLLFSDDGTGALDTATGILGTAGASAGGYDVYSLDISALATADMNDVLSD
FT                   VDDALSAMTSAAAELGSISMRIGLQEDFVAKLSDSIDSGVGRLVDADMNEESTRLKALQ
FT                   TQQQLAVQSLSIANSNSENVLQLFR"
FT   gene            324418..325335
FT                   /locus_tag="NGR_c02860"
FT   CDS_pept        324418..325335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02860"
FT                   /product="putative flagellin A"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02860"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24084"
FT                   /db_xref="GOA:C3MG33"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG33"
FT                   /protein_id="ACP24084.1"
FT                   /translation="MTSILTNTAAMAALQTLRAIDDNMETTQGRVSSGLRVGEAADNAA
FT                   YWSIATTMRSDNMALSAVQDALGLGAAKVDTSYAAMESAIEVVKEIKSKIVAATEEGVD
FT                   KTKIQEEIDQLQEQLMSIAESASFSGENWVAGDAADKSVVSGFVRASDGTVSVKTTTYT
FT                   LDDTATGNLLFGGDGAGAIVDTNGILGTTGGATIGVSIYALDITGFDTAEMAEALTLVE
FT                   DGLQAMTSAASELGSISMRIGLQEDFVAALTDSIDSGIGRLVDADMNEESTRLKALQTQ
FT                   QQLAVQSLSIANTNSENILQLFRQ"
FT   gene            325638..326600
FT                   /locus_tag="NGR_c02870"
FT   CDS_pept        325638..326600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02870"
FT                   /product="flagellin protein FlaD"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02870"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24085"
FT                   /db_xref="GOA:C3MG34"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG34"
FT                   /protein_id="ACP24085.1"
FT                   /translation="MTSIMTNAAAMAALQTLRSINRNLDETQSRVSSGYRVETAADNAA
FT                   YWSIATTMRSDNAALSTVQDALGLGAAKVDTAYAALDTVIDLMSEVKAKLVAAREPGVD
FT                   KTKIDKELAQLKEQLVSAAQSASFSGENWLYNDAATAVGTKSIVASFNRSADGSVSVTT
FT                   LDYDTSGSILVDVQDASRGLLTMAVDADTLVSAPTGSAREYYLIDAGSPPAGTEIALSE
FT                   TTTDEELDDMISVVDDLVSQLTNSAATLGAITSRIEMQENFVANLMDVIDKGVGRLVDA
FT                   DMNEESTRLKALQTQQQLGIQSLSIANTNSENILRLFQE"
FT   gene            326975..327628
FT                   /locus_tag="NGR_c02880"
FT   CDS_pept        326975..327628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02880"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24086"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG35"
FT                   /protein_id="ACP24086.1"
FT                   /translation="MSASLSRYLKDFSAPKIELTRMPPKYFPDLEADFPTEDRSAQRPT
FT                   MPEIDVDAERREAFAQGRAEAAAELAFEHQRELAELKARHAEELDAVRHRLAEETASKL
FT                   AAGFDQITERLALALGDQTARVLAPVLEAALLKRAIEDLATMIRQGVGAGEGLTITVKG
FT                   SPVLFEALKQHLDDDTLLFRHVVADDIDLTVELGETVLVTRMAAWSDTVRKVLA"
FT   gene            327625..328803
FT                   /gene="motB"
FT                   /locus_tag="NGR_c02890"
FT   CDS_pept        327625..328803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="NGR_c02890"
FT                   /product="chemotaxis protein motility protein B"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02890"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24087"
FT                   /db_xref="GOA:C3MG36"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG36"
FT                   /protein_id="ACP24087.1"
FT                   /translation="MSEESHHNGKNEIIIVKRSGDGHDGHHGGGWKIAYADFMTAMMAF
FT                   FLVMWLINAANEETKAAIASYFNPVQLTDQKPAEKGLKNPAKDAQGEETQQRSKSDGEQ
FT                   TKSGGSAKTGDQLTATSGEETKYSDADFFENPYSVLSEIAKEAGQQANISAKGEGGAAQ
FT                   SGPATGAEGGEAYRDPFDPDFWTKQVEVKDAGNATEGDVADADAGNNPAAGEALKTAEA
FT                   RKGEVPLEQEAEAQQQQKEAEALKAEIEKAVGGEAGRLLEGLVVTPSEGGLLVTISEQT
FT                   DAPMFAVGSAVPAKDLVLAMEKIGTLLAERQGAVAIRGHTDGRPFKDGTYDNWRLSAAR
FT                   AQSAYYMLVRGGLKEQRVNQISGFADRRLQVPNDPYAAANRRIEILLQSGQG"
FT   gene            328809..330116
FT                   /gene="motC"
FT                   /locus_tag="NGR_c02900"
FT   CDS_pept        328809..330116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motC"
FT                   /locus_tag="NGR_c02900"
FT                   /product="chemotaxis protein motility protein C"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02900"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24088"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG37"
FT                   /protein_id="ACP24088.1"
FT                   /translation="MLKRLGAILATSVLAVPLAIGLARASETEELAPFKMVRSLQYVQD
FT                   SVVLGDHSAIEMQRFMLNKIDKRLRAADEAIFRDPRNVDAALVYVMSGGNPETLDYLTD
FT                   RDVEGNFDARVAEALRQYLRGKGPLIVENLAKAAPEYKNSRVGPYLFLILGNATSQQDP
FT                   VAAMKYYDWARLTAPGTIIEEAALRRSVSLAVQAGDPEKGFRYALNYARRYLTSPYASQ
FT                   FADVFVELAVTHFDETVEKRVAEILAFMDQSRQREVYLRVARRAAIGGNQTLARLASSR
FT                   AEELALDGGGQSQLLASFYDGLAAVPSEDVFTAAQTLAAIPDGKLSRRDRALREAARAI
FT                   AEEVVRLPRDESSAQASMPIPEANTGPAKDGGETGETGSGMSPFAVASDRPPAPGGERP
FT                   ASAETAAASDPALDGFVANGRSKIKEIDALLAEEGL"
FT   gene            330113..331594
FT                   /gene="motD"
FT                   /locus_tag="NGR_c02910"
FT   CDS_pept        330113..331594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motD"
FT                   /locus_tag="NGR_c02910"
FT                   /product="chemotaxis protein motility protein D"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02910"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24089"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG38"
FT                   /protein_id="ACP24089.1"
FT                   /translation="MRPLEETFRAPAAAVGARPGSRQGGNEQVAGEPGAFESAVADAGR
FT                   QKTAAQGAAQGSGESAVDSAAEGTQTAAAEFTIGKPKAGVLIASATITGTGRLSTPSAK
FT                   GRGEGDADGALAEGQASSELKSVREKGNRQFSAAQADLEAEEASDPDGKAVTGKPKGHM
FT                   AAQTGAMEYSEAGATPEGDTGSAAPANGPVSDLLSLLGSAPPAAALDTAGGENTSNAAR
FT                   STGGRVAALAAETADVPADADAAEGSRTGEQGDAGSDRLFRFARADGKGQAVSMSISAD
FT                   GEATAVENGRPTANAKAEAVTVLEARRYLGVAMNTNSAAVTGAIAGDGAWAQALQSSAL
FT                   STQPEASSLAGKTLNTLKIQMHPIELGTVTATLRLKDDELQVDLKVETGEAFRQLRDDQ
FT                   SEMVKALRAQGFAVDQVNVVFNAGGDASNGSGSQPQTQGQLGQSAGERTGGDSGQGRQR
FT                   PNGGEAAQAETWWGNDGTDDAAAGVGHSRTGDVYM"
FT   gene            331533..332096
FT                   /locus_tag="NGR_c02920"
FT   CDS_pept        331533..332096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02920"
FT                   /product="putative lytic transglycosylase-like protein,
FT                   catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02920"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24090"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG39"
FT                   /protein_id="ACP24090.1"
FT                   /translation="MERTMRLLALGTLALVTSTCSALASAGICEREIASAAAKYGIPTG
FT                   ILYSVGLTETGRKGSLQPYAMNIEGKAYFGTSVQDVLGRFGAARAQGAKLIDLGCMQIN
FT                   YHFHGEHFSSPEEMLDPRRNVDYAARFLSNLRARHESWTMAVARYHAGPNNDPAQKKYV
FT                   CRVIANLVATGYGKWTPNAAQFCQ"
FT   gene            332368..333039
FT                   /locus_tag="NGR_c02930"
FT   CDS_pept        332368..333039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c02930"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02930"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24091"
FT                   /db_xref="GOA:C3MG40"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG40"
FT                   /protein_id="ACP24091.1"
FT                   /translation="MIVVVDERELVKDGYASLFGREGIPSTGFDPKDFGEWVNTAADSD
FT                   IDAVEAFLIGQGESAFSLPRAIRDRSQAPVIAMSDTPSLENTLALFDCGVDDVVRKPVH
FT                   PREILARVAAIRRRLKAIANYTDIGPIRVFADGRDPEINGEVFALPRRERRILEYLVAN
FT                   RGRRVSKSQIFNAIYGIFDEDVEENVVESHISKLRKKLRKKLGFDPIDSKRFLGYCIDW
FT                   N"
FT   gene            333127..334341
FT                   /gene="flgE"
FT                   /locus_tag="NGR_c02940"
FT   CDS_pept        333127..334341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /locus_tag="NGR_c02940"
FT                   /product="putative flagellar hook protein FlgE"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02940"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24092"
FT                   /db_xref="GOA:C3MG41"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG41"
FT                   /protein_id="ACP24092.1"
FT                   /translation="MSLYGTMRTGVSGMNAQANRLSTVAENIANSSTTGYKRASTEFSS
FT                   MILPSSNGSYNSGGVETSVRYSISDQGSTTYTTSASDLAIDGDGFFIVQGANGQEYLTR
FT                   AGAFVQDDSGNLVNAAGFTLMGYEYEAGVDPTVVVNGFDGLTEVNLASDGLTAAGSTAG
FT                   AMGANLPSGAANGDVSTTSLVVYDTQGNTRILDFNYTKVADNQWELDIVDRTSATSLGT
FT                   ATLDFDADGVLTTSPATLTLDGTLISPITGTGAELNNITIDFTETTQLGTSFTPDGGSI
FT                   DGNAPSKVSGYQIDTDGVVYIKYANGELEPRYRIALASVQSPDKLVPESGNVYSQGVDS
FT                   GVIVTGFAGSGSFGEILSGALESSNVDIADELTSMIESQRNYTANSKVFQTGSELLEVL
FT                   VNLKR"
FT   gene            334363..335793
FT                   /gene="flgK"
FT                   /locus_tag="NGR_c02950"
FT   CDS_pept        334363..335793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /locus_tag="NGR_c02950"
FT                   /product="predicted flagellar hook-associated protein FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02950"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24093"
FT                   /db_xref="GOA:C3MG42"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG42"
FT                   /protein_id="ACP24093.1"
FT                   /translation="MSLSSAIAIAQSAFSTTASQTATVSKNVANASNADYSRRMAMLGT
FT                   TADGAQIVSIYRAQNEALLKQNLTSISQSSAQSSLLSGLELLKSALGGNDYETAPSTYL
FT                   SAFRDSLQTFASTPGNSTIAATVVADASDLANSISKTATAVQDLRLDTDKQIAEEVDNL
FT                   NALLASFETANNAVKQATATGADATAALDERDKLLKQLSELVGISTVTRADNDTVIYTS
FT                   DGTVLFETQARQVTFTATSAFDASTTGNAIFIDGVSLSAGAGADTTAEGKLASLLQLRD
FT                   DIAPTFQSQLDEMARGLVSLFQEDGAPGLFTWEDGTLPADGTVEPGIAATLSVNAAAQT
FT                   NPFLLRDGGFNGLVSNPGGATDPNSGYTDLLDGFITAMDGDMDFDAAAGLDSTSSIMEF
FT                   AASSIGWFEQIRSAASTADDNKTALLARTEEALGNVTGVSIDEELSLLLDLEQSYKASA
FT                   KLISTVDAMMASLLEAVR"
FT   gene            335796..336848
FT                   /gene="flgL"
FT                   /locus_tag="NGR_c02960"
FT   CDS_pept        335796..336848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /locus_tag="NGR_c02960"
FT                   /product="predicted flagellar hook-associated protein FlgL"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02960"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24094"
FT                   /db_xref="GOA:C3MG43"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG43"
FT                   /protein_id="ACP24094.1"
FT                   /translation="MKTSFVSNLAVQNAMRLTIQQGQEELLKLQTEVSTGRHADVGLEL
FT                   GSSTARSVNLQRELARLETLVDTNSVVTQRLASSQQALGTMAEAAEQVRNTLVTFKGND
FT                   SVDQLSVQKTEIESAMSLFTASANTSFNGEFLFAGINTDVKPFEDYAASGSAAKTTFDD
FT                   ALATYMSANGIASMSDFTEAQMEDFITNTLEPLYTDDAQWAGDWSAASSQNMTSRISTS
FT                   EVVQSSTNATTSGFRMFALASVISSELMDEDIGSEVRAYIGEASLGYVEQAITGLTAER
FT                   STLGISEARVEKANTSLEVQIKLINTHITDLEGVDTYDASTRMNTLLTQMETSYTLTGR
FT                   IQQLSLIDFL"
FT   gene            336886..337233
FT                   /gene="flaF"
FT                   /locus_tag="NGR_c02970"
FT   CDS_pept        336886..337233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flaF"
FT                   /locus_tag="NGR_c02970"
FT                   /product="predicted flagellar protein FlaF"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02970"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24095"
FT                   /db_xref="GOA:C3MG44"
FT                   /db_xref="InterPro:IPR010845"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG44"
FT                   /protein_id="ACP24095.1"
FT                   /translation="MYQFAYAEIMEEGVAVSKDREWQVLNRSIALLEAAKQQKGYSREA
FT                   IEAIYYTRRVWIRFIEDLRAPDNQLNDELRANLISIGIWILNETEKIRKRDSSNFQGII
FT                   DITTIIRDGLK"
FT   gene            337230..337679
FT                   /gene="flbT"
FT                   /locus_tag="NGR_c02980"
FT   CDS_pept        337230..337679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flbT"
FT                   /locus_tag="NGR_c02980"
FT                   /product="predicted flagellum biosynthesis repressor
FT                   protein FlbT"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02980"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24096"
FT                   /db_xref="GOA:C3MG45"
FT                   /db_xref="InterPro:IPR009967"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MG45"
FT                   /protein_id="ACP24096.1"
FT                   /translation="MKSTLRISLKSGERIFVNGAVLRVDRKVAVEFLNDVTFLLENHVL
FT                   QPEDATTPLRQLYFIAQMILINPEGAEQSTAMFRKSIVMLLACFKNEEVLAELKRIDGL
FT                   VTQGRAFEALKAIRGLYPIEERILNNQEITPATIDQIRKEIAPWR"
FT   gene            337670..338116
FT                   /gene="flgD"
FT                   /locus_tag="NGR_c02990"
FT   CDS_pept        337670..338116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="NGR_c02990"
FT                   /product="predicted flagellar hook capping protein FlgD"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02990"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24097"
FT                   /db_xref="InterPro:IPR005648"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG46"
FT                   /protein_id="ACP24097.1"
FT                   /translation="MAVSGVSSSASASTTSTTSTTSTSSTDAADATLNYQSFLKLLIAQ
FT                   MQNQDPTDPMDATEQISQLATFSQVEQSIKTNSNLESLLASESLTQASTYIGKTITSSD
FT                   GKTSGVVAEVEVTSDGVTAITTDGKEIAIETGISVSTTSSDSET"
FT   gene            338286..338552
FT                   /gene="fliQ"
FT                   /locus_tag="NGR_c03000"
FT   CDS_pept        338286..338552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="NGR_c03000"
FT                   /product="flagellar biosynthetic protein FliQ"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03000"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24098"
FT                   /db_xref="GOA:C3MG47"
FT                   /db_xref="InterPro:IPR002191"
FT                   /db_xref="InterPro:IPR006305"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG47"
FT                   /protein_id="ACP24098.1"
FT                   /translation="MNEADALDIVQAAIWTVIVASGPAVLAAMVVGVVIAFIQALTQVQ
FT                   EMTLTFVPKILAVMVTAAISAPFVGAQISIFTDIIFSRIQSGF"
FT   gene            338666..340753
FT                   /gene="flhA"
FT                   /locus_tag="NGR_c03010"
FT   CDS_pept        338666..340753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhA"
FT                   /locus_tag="NGR_c03010"
FT                   /product="flagellar biosynthesis protein FlhA"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03010"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24099"
FT                   /db_xref="GOA:C3MG48"
FT                   /db_xref="InterPro:IPR001712"
FT                   /db_xref="InterPro:IPR006301"
FT                   /db_xref="InterPro:IPR042193"
FT                   /db_xref="InterPro:IPR042194"
FT                   /db_xref="InterPro:IPR042196"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG48"
FT                   /protein_id="ACP24099.1"
FT                   /translation="MAQQATLTIPKLAPKSRDIGFALGIVMILSILFLPIPPFLIDFGL
FT                   AFSIAFSVLILMVALWIQRPLEFSSFPTILLISTMTRLALNIATTRVILSHGHEGHGAA
FT                   GGVISGFASLVMSGDFVIGLIVFLILITVNFIVITKGATRIAEVGARFTLDAIPGKQMA
FT                   IDADLSAGLIDEKEAQRRRRELEEESSFFGAMDGASKFVRGDAIAGLIITAINIFGGII
FT                   IGYLRHDMPIGEAADVFVKLSVGDGLVSQIPALIVSLAAGLLVSRGGTAGSTDQAVVGQ
FT                   LSGYPRALMVAAGLIVMLSVMPGLPFVPFAVLGGGMAFLGWFIPRQIEAANAERRAQEA
FT                   EKAQQTKDSDKDSVKSVLKTAEIELLLGKQVSTRLLGAHQELAFRVGKMRRKFALQYGL
FT                   VVPEIKVSDDITIPDKAYHVRIHGTTIASNTVRVGEVLVVTGGGRRPSVPGDEIREPAF
FT                   GMPALSILETFTDDLKREGFHPIDNVSVVLTHLSEVIRNNLPQLLSYKDVKVLIERLDP
FT                   EYRKLADEICTSHMSYSGLQAVLKLLLAERVSIRNLHLILEAVAELAPHVRKTEQIVEH
FT                   VRVRMSQQLCGDLAENGVLRVLRLGNKWDMVFHQALKRDAKGEIVEFDIDPRQLEEFSE
FT                   QATKVIREHLDRGVPFVLVSSPESRSYVRMIIERLFATLPVLSHVELAKGLEIKIIGAL
FT                   S"
FT   gene            340750..341502
FT                   /gene="fliR"
FT                   /locus_tag="NGR_c03020"
FT   CDS_pept        340750..341502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /locus_tag="NGR_c03020"
FT                   /product="flagellar biosynthesis protein FliR"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03020"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24100"
FT                   /db_xref="GOA:C3MG49"
FT                   /db_xref="InterPro:IPR002010"
FT                   /db_xref="InterPro:IPR006303"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG49"
FT                   /protein_id="ACP24100.1"
FT                   /translation="MITDPEGTVLALFAAFCRIGGCIMIMPGFSTARVPMQVRLFIAVA
FT                   LSMAILPIMWTDIYPQVAGKGHTYIYLIATESVIGAVIGLVARYYVLGLQFAGTAITML
FT                   IGFNPPPATDVLEETAENQLTSMISFAGLMLLFMLDFHHVIFEAIAQSYRVMPIGIGFD
FT                   PQGMLITLTNSLGQTFLIMLRLASPFVIYGLLFNVAIGMVNRLAPQVPVYFISQPYLIL
FT                   GGLFLLYLGIAAMLRLFADGFAPVMQGG"
FT   gene            341514..341927
FT                   /locus_tag="NGR_c03030"
FT   CDS_pept        341514..341927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03030"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03030"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24101"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG50"
FT                   /protein_id="ACP24101.1"
FT                   /translation="MKSRSKKLKRLVDVQRHLERMAESELAETTRQRGVLSETIDVVVD
FT                   AMGSAHPMHRVFSGHYAAQLGRLVQKDQMLLGIQQVHEARMLKERAKGDRLQESMEEAR
FT                   MTEDREADDNQVLDLIDQHVAGYAPASGKLEGR"
FT   gene            342017..342562
FT                   /locus_tag="NGR_c03040"
FT   CDS_pept        342017..342562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03040"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24102"
FT                   /db_xref="InterPro:IPR019301"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGI7"
FT                   /protein_id="ACP24102.1"
FT                   /translation="MAISPPSDLVLDVVRAADPAEVQEAQTRLKANRAAFQATSLAENG
FT                   NGFAAAVSVLNSSEGSTGLGDVSNRVEPKKVPETYRKFEAMVLQNFVKSMLPSESESVF
FT                   GKGTSGEVWKGMMAEQIANVLADGGGIGIADRMAGSDTADRASARLDDDTSNIAAGMVH
FT                   EYERKAGFFTTDDKKNQA"
FT   gene            342635..343003
FT                   /locus_tag="NGR_c03050"
FT   CDS_pept        342635..343003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03050"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24103"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGI8"
FT                   /protein_id="ACP24103.1"
FT                   /translation="MEAVASHDLRIQNVLGRLEMIIDNENSRIGVDPKFDIKTSNAHKS
FT                   RCLYELTMLHRDTAAGEISPSFASQTRHLRQKLKLNAQKVEAHLEAVRSVVDLLKTAAQ
FT                   DADADGIYTEAQFRYSDF"
FT   gene            343003..343569
FT                   /locus_tag="NGR_c03060"
FT   CDS_pept        343003..343569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03060"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24104"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGI9"
FT                   /protein_id="ACP24104.1"
FT                   /translation="MLKLVLTGVWVCAVTLGSVYFSMQYASAPIVSDAEADRRASEEYV
FT                   PGEIITVPVIEEGAVQGYFLAKLSFSATREGIAKLHAPLRQVVTDELYDMLVGSRFVDV
FT                   ADTGTFDLPSFKVAVKDGLNKKLGGEVITEVLVEQLEYLGKDDMKRVANGNNRPYQEPV
FT                   PVVDKHGNVASDKIPEGAVKASSGH"
FT   gene            complement(343591..344580)
FT                   /locus_tag="NGR_c03070"
FT   CDS_pept        complement(343591..344580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03070"
FT                   /product="putative glycosyl transferase family 2"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03070"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24105"
FT                   /db_xref="GOA:C3MGJ0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGJ0"
FT                   /protein_id="ACP24105.1"
FT                   /translation="MTPTGEDISIHFQSELENAADIELVVVVPTFRRPDHLVKTLKTIV
FT                   SQRPDFPCATLVVENDPDGQSGAEAAKRFFLEHRSDSTVIVAHRRGHSHACNAGWATAL
FT                   DLYPNLRAVAVIYDDAVAAPEWLDCLVAVREGHGADIAGGPQLPVFEDADGQKWKKHPI
FT                   FSPSYEATGPVPRLYSAGNVLITRAVLDAMPRPFLNPALNLVGVGDGDFFNRCRAKGFS
FT                   FAWAAEAWVAETVPPDHTTASWIRARSLEQGAISTLLEQQGDAGLTARLRTFGKSIALL
FT                   AVSLPRGLKLWAQTGLATASLYHFHVALGRLTATMGLADEEHGAPGER"
FT   gene            345059..345958
FT                   /gene="folD2"
FT                   /locus_tag="NGR_c03080"
FT   CDS_pept        345059..345958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folD2"
FT                   /locus_tag="NGR_c03080"
FT                   /product="bifunctional protein FolD2; includes:
FT                   Methylenetetrahydrofolatedehydrogenase ;
FT                   Methenyltetrahydrofolate cyclohydrolase"
FT                   /EC_number="1.5.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03080"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24106"
FT                   /db_xref="GOA:C3MGJ1"
FT                   /db_xref="InterPro:IPR000672"
FT                   /db_xref="InterPro:IPR020630"
FT                   /db_xref="InterPro:IPR020631"
FT                   /db_xref="InterPro:IPR020867"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGJ1"
FT                   /protein_id="ACP24106.1"
FT                   /translation="MTTVIDGKAVAASVIETVKSATQTLETETGVRAGLAVVIVGDDPA
FT                   SHAYVSAKSRMAKECGFLSVQHTLPGETSQEELAALVAELNADPSIHGILVQLPLPKHL
FT                   QSEPIIQSILPEKDVDGLHVVNAGKVATGDLDGGLVSCTPAGAMVFVRRTHGGDLSGLN
FT                   AVVIGRSNLFGKPMSALLLAANATVTTAHSRTKDLAAVCRNADILVAAVGRPEMVKADW
FT                   VKPGALVIDVGINRVAAPERGEGRTKLVGDVAFEECAKVASVITPVPGGVGPMTIAMLM
FT                   ANTIIAAYRKAGQNPPKF"
FT   gene            complement(345963..346994)
FT                   /locus_tag="NGR_c03090"
FT   CDS_pept        complement(345963..346994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03090"
FT                   /product="putative HTH-type transcriptional regulator, LacI
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03090"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24107"
FT                   /db_xref="GOA:C3MGJ2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGJ2"
FT                   /protein_id="ACP24107.1"
FT                   /translation="MAVNLKQLAEILGLSQTTVSRALNGYPEVNAETRQRVLQAVRETG
FT                   YRPNRAAQRLATGKAYSIGLVMPIAPGIDSDIHFGEFLAGLAEESVKHDFHFVINPSAP
FT                   DDEEATFRRLAASGNVDAVFLAYMRANDPRIPMLKALSIPFVVHGRSIGGPRDYPFLDI
FT                   DNTQAFYDATKLLLQLGHHRIGLINGPDYLAFSMRRKKGVTRALEEWGLGLDEELVHHS
FT                   VMADEYGYRSMQHFLERPDPPTAVLCSSTVLALGAVRAINRAGLVLGSDISIIAHDDVL
FT                   PMLKPENFSVPLTTTRSSLRAAGARIATRLIGGIVGRGDYPEQELWRAELIVRASTGPA
FT                   PGR"
FT   gene            347293..348651
FT                   /locus_tag="NGR_c03100"
FT   CDS_pept        347293..348651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03100"
FT                   /product="predicted alpha-glucoside ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03100"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24108"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGJ3"
FT                   /protein_id="ACP24108.1"
FT                   /translation="MKRSLLIGVAALALLAGAASAADLKFKPGEDSKFNWGSFEEFKKG
FT                   HDLKGQTLTIFGPWRGEDEALFKSVFAYFVEATGVEVKYSSSENYEQQIVIDTQAGSPP
FT                   DVAILPQPGLIADLAAKGLLTPLGDETKQWLLDNYAAGQSWVDLSTYSGKDGAAALYAF
FT                   PYKIDVKSLVWYVPENFEDAGYEVPKTMEELKALTEKIAADGEKPWCIGLGSGGATGWP
FT                   ATDWVEDLMLRTQSPEVYDKWTKNEIPFTDPAVTGALDEFGWFARNDKFVDGGAAAVAS
FT                   TDFRDSPKGLFASPPKCYLHHQASFIPSFFPEGTVVGEDADFFYMPPYESKKELGNPVL
FT                   GAGTLAMITKDTPAARAFIEFLKTPIAHEVWMAQTSFLTPYKSVNVEVYGNPPLKKQGE
FT                   ILLNATTFRFDGSDLMPGKIGAGALWTGMVDYVGGKSSADVAADVQKAWDAIK"
FT   gene            348902..349909
FT                   /locus_tag="NGR_c03110"
FT   CDS_pept        348902..349909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03110"
FT                   /product="predicted alpha-glucoside transport system
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03110"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24109"
FT                   /db_xref="GOA:C3MGJ4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGJ4"
FT                   /protein_id="ACP24109.1"
FT                   /translation="MQLLAAILTMIVGVLACAAYFWATNFILDRIFPSKGLSGVTASRN
FT                   LRITNAIRPWLFLAPALFALTIYLIYPVVQSVWLSFHDRGGQSFVGARNYSWMINDGEF
FT                   RQSIFNNFLWLLVVPALSTFFGLIIAALTDRIWWGNIAKTLIFMPMAISFVGAAVIWKF
FT                   IYDYRAEGSEQIGLLNAIVVAFGGAPEAWITLPFWNNFFLMVILIWIQTGFAMVILSAA
FT                   LRGIPEETIEAAVIDGANGWQIFFKIMVPQIWGTIAVVWTTITILVLKVFDIVLAMTNG
FT                   QWQSQVLANLMFDWMFRGGGDFGRGASIAVVIMVLVIPIMIWNIRNATKESGGH"
FT   gene            349911..351059
FT                   /locus_tag="NGR_c03120"
FT   CDS_pept        349911..351059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03120"
FT                   /product="predicted alpha-glucoside ABC transport system
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03120"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24110"
FT                   /db_xref="GOA:C3MGJ5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGJ5"
FT                   /protein_id="ACP24110.1"
FT                   /translation="MNPSTRSPLTWAVHLSVLLLVVLWTMPTAGLLISSLRDKDQLAVS
FT                   GWWTALATSSRNDVARAPSADSQVERDGKFVISGNLLEGQGGGQISAFGFSSREPGKFK
FT                   AGETAELNDGERLTVQADGSFEIVSDTKMEGSRGQRIFYTAATPPRFTIDNYIEVLSAA
FT                   GIGTSFLNSLTVAIPSTVIPILIAAFAAYALAWMPFPGRAILLAVVVGLLVVPLQMSLI
FT                   PLLQLYNGVGAFFGVPAKTYMGIWLAHTGFGLPLAIYLLRNYMAGLPREIMESARVDGA
FT                   SDFDIFVKIILPLSFPALASFAIFQFLWTWNDLLVAIVFLGAGEDSLVLTGRLVNLLGS
FT                   RGGNWEILTASAFITIVVPLIVFFALQRYLVRGLLAGSVKGG"
FT   gene            351086..352741
FT                   /gene="aglA1"
FT                   /locus_tag="NGR_c03130"
FT   CDS_pept        351086..352741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aglA1"
FT                   /locus_tag="NGR_c03130"
FT                   /product="alpha-glucosidase"
FT                   /EC_number="3.2.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03130"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24111"
FT                   /db_xref="GOA:C3MGJ6"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGJ6"
FT                   /protein_id="ACP24111.1"
FT                   /translation="MTKTETSGAILTADKDWWRGAVIYQIYPRSFQDTNGDGIGDLKGI
FT                   TARLPHVAALGADAIWISPFFTSPMRDFGYDVSNYTDVDPIFGTLKDFDLLIAEAHRLG
FT                   LRVMIDLVLSHTSDQHPWFVESRSSRSNAKADWYVWANSKPDGTPPNNWLSIFGGSAWA
FT                   WDPTRLQYYLHNFLTAQPDLNLHNRQVQEALLAVERFWLERGVDGFRLDTINFYFHDRE
FT                   LRDNPALAPERRNASTAPAVNPYNYQEHIYDKNRPENLEFLKRFRAVMDEFPAIAAVGE
FT                   VGDSQRGLEIAGEYTSGGDKVQMCYAFEFLSPDPLTPERVVEVMRDFQKVAPEGWACWA
FT                   FANHDVVRHVSRWGSGVADHAGHAKMLASLMMSLRGSVCLYQGEELALPEAELAYEDLQ
FT                   DPYGIQFWPDFKGRDGCRTPMVWEGLPDGGFSSAKPWLPIPEAHLPQAVAVQEGDPASV
FT                   LEHYRRFLNFRKAHAALAKGDIEFVETRAPLLGFLRIHGNDRLFCLFNMGEEPAAADLP
FT                   EGTVEPLDGHGFISDIRDNKISLPAWGAFFARLA"
FT   gene            352762..353850
FT                   /locus_tag="NGR_c03140"
FT   CDS_pept        352762..353850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03140"
FT                   /product="alpha-glucoside ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03140"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24112"
FT                   /db_xref="GOA:C3MGJ7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGJ7"
FT                   /protein_id="ACP24112.1"
FT                   /translation="MTGLLLKDIRKSYGAVDVIHGINLDIKQGEFVVFVGPSGCGKSTL
FT                   LRMIAGLEEITGGDMFIDGQRVNEVPPSQRGIAMVFQSYALYPHMTVYDNMAFGMRIAK
FT                   ETKEEIDRRVRSAADILQLTKYLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSN
FT                   LDAALRVATRIEIAKLSERMADTTMIYVTHDQVEAMTLADRIVVLSLGHIEQVGAPLEL
FT                   YERPANLFVARFIGSPAMNVFPSTITATGAQTTVTLAGGKSVTLDIPTNASEAGKKASF
FT                   GVRPEDLQVTDGQDFLFEGTISIVEALGEVTLLYIEGLVENEPIIAKIPGILKVGRGDK
FT                   VRFTADKAKLHLFDADGRSYRA"
FT   gene            353966..354394
FT                   /locus_tag="NGR_c03150"
FT   CDS_pept        353966..354394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03150"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24113"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGJ8"
FT                   /protein_id="ACP24113.1"
FT                   /translation="MRKVYSMRSDAPVMQQHFLNKEESFMYDREANFPMEDTRNDARIE
FT                   FTEKGMQNLSSRRCEIIKLSKSSAVIGIVTKFQLPQNFYLDIPSARIPLIGCLLKRVHA
FT                   NNLIEARFLRLLSDRDLNRIFVYSTHPNHRNRTLDIYR"
FT   gene            354428..354805
FT                   /locus_tag="NGR_c03160"
FT   CDS_pept        354428..354805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03160"
FT                   /product="hypothetical protein"
FT                   /note="similar to glutathione-dependent
FT                   formaldehyde-activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03160"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24114"
FT                   /db_xref="GOA:C3MGJ9"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGJ9"
FT                   /protein_id="ACP24114.1"
FT                   /translation="MRAAMQRPYRLSCHCGEIAIEVDAELSRLVECNCSTCRRSGFLHW
FT                   KVDAAAVRLLTEKRRMSTYIWRGIGEGHHFCPTCGTAILRSGYPGDRVSLNARCIEGVD
FT                   VFTLEVDRYDGRNDMPPGPLP"
FT   gene            complement(354833..356653)
FT                   /locus_tag="NGR_c03170"
FT   CDS_pept        complement(354833..356653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03170"
FT                   /product="phosphogluconate dehydratase"
FT                   /EC_number="4.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03170"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24115"
FT                   /db_xref="GOA:C3MGK0"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004786"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGK0"
FT                   /protein_id="ACP24115.1"
FT                   /translation="MSADSRIAAITARIVERSKPYREPYLDRVRSAAATGPHRSVLGCG
FT                   NLAHGFAVCSPAEKVALAGDRVPNLGIITSYNDMLSAHQPFETYPALIREAAREAGGVA
FT                   QVAGGVPAMCDGVTQGQPGMELSLFSRDLIAMAAGIGLSHNMFDAAVYLGVCDKIVPGL
FT                   VIAALTFGHLPAVFVPAGPMTSGLPNDEKAKVRQLFAEGKVGRDELLEAESKSYHGPGT
FT                   CTFYGTANSNQMLMEIMGFHLPGASFINPGTPLRDALTKEAAKRALAITAMGNEFTPAG
FT                   EMIDERSIVNGVVGLHATGGSTNHTMHLVAMARAAGIVLTWQDISELSDIVPLLARVYP
FT                   NGLADVNHFHAAGGMGFLIAQLLKTGLLHDDVRTVYGQGLEAYAIDVKLGEKGTVQREP
FT                   APEESADPKVLSTIDQPFQHTGGLKMLTGNIGKAVIKISAVKPDRHVIEAPAKIFNDQA
FT                   ELNAAFKAGTLEGDFIAVVRFQGPKANGMPELHKLTTILGILQDRGQKVALVTDGRMSG
FT                   ASGKVPAAIHVTPEAKDGGPIARIQEGDIIRIDAVKGTIEVKVDDIALKTRVPAHVDLS
FT                   DNEFGMGRELFAPFRKIAGAADHGGSVLFN"
FT   gene            complement(356778..357476)
FT                   /locus_tag="NGR_c03180"
FT   CDS_pept        complement(356778..357476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03180"
FT                   /product="6-phosphogluconolactonase"
FT                   /EC_number="3.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03180"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24116"
FT                   /db_xref="GOA:C3MGK1"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGK1"
FT                   /protein_id="ACP24116.1"
FT                   /translation="MSETLHTYENGAALAEGLADAVSARLAAAIAERGAASIAVSGGST
FT                   PKAFFRALCARDIDWAKVTITLVDERFVPPESDRSNHALVAANLMQNRAAAAQFVPLYH
FT                   AAATAEAAAAIASEKTAGIAAPFDVVVLGMGTDGHTASFFPGGTRLEEALDPATRRGVI
FT                   TMEAAGAGETRLTFTFSSLHDAGYLVLHIEGEGKREVLGRAEAAGEETEMPIRAMLRRA
FT                   ASPLQIYWAP"
FT   gene            complement(357486..358961)
FT                   /locus_tag="NGR_c03190"
FT   CDS_pept        complement(357486..358961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03190"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03190"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24117"
FT                   /db_xref="GOA:C3MGK2"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGK2"
FT                   /protein_id="ACP24117.1"
FT                   /translation="MSSQIIPVEPFDYVVFGGTGDLAERKLLPALYHRQIEGQFSEPTR
FT                   IIGASRAALTDGEYRQFASDALKEHLKPGEFDEAEVETFTSRLHYVSVDAKSEQGWDDL
FT                   KKILDEGKDRTRAFYLAVGPAIFGDISEKIRDHKLITRNTRIVVEKPIGRDLASATELN
FT                   DTIGKVFREEQIFRIDHYLGKETVQNLMALRFANALYEPLWNSAHIDHVQITVAESVGL
FT                   ENRAGYYDKAGALRDMVQNHILQLVCFVAMEAPTSMDAEAVRDEKLKVLRALKPITAAN
FT                   VEQVTVRGQYRAGASAGGPVKGYLEELEGGVSNTETFVAIKAEISNWRWAGVPFYIRTG
FT                   KRMAGRMSEIVITFKQIPHSIFDNSAGRISANQLMIRLQPNEGVKQSLMIKDPGPGGMR
FT                   LRNVPLDMSFAEAFGVRNADAYERLLLDVIRNNQTLFVRRDEVEAAWQWIDPILKAWET
FT                   AGQQVQGYTAGTWGPSQAIALIERDGRTWNDTI"
FT   gene            complement(359128..360414)
FT                   /gene="ordL"
FT                   /locus_tag="NGR_c03200"
FT   CDS_pept        complement(359128..360414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ordL"
FT                   /locus_tag="NGR_c03200"
FT                   /product="probable oxidoreductase OrdL"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03200"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24118"
FT                   /db_xref="GOA:C3MGK3"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGK3"
FT                   /protein_id="ACP24118.1"
FT                   /translation="MEWQSPISPGISWYEATVPDRPGYPAMPGSRRADVAIVGGGYTGL
FT                   QAAYNLAKGGADVTLIDACRFGDGASGRNGGQFGTGQRAWADEAEETLGHERAQLLFDM
FT                   AENAKRYVLDFASEHRIDIEFVPGQLSVSHKKSFETDYRRHVDAMAERFGYPHLTFMDR
FT                   EETSSRLGSSHYHFGIRDTGTGHIHPMKLLVGLTRQAALAGANLYEQTKALKIEKKGGA
FT                   VVIETSRGTITADRALIACNAYIGDLEPVTASHVMPIRSFIGATPVLRDHPDILPGGES
FT                   VDDSRFVVRYFRKSKDGRLLFGGREAYTADNPRDISSHIRRQIHEIYPALADIDITHAW
FT                   GGSVGITMPRQPFCREVMPGVTSIGGYSGHGVMLANYCGKLYAGLALGRATELELLREL
FT                   KIPAFPGGTRFRSVLLFLALSWYALRDRL"
FT   gene            complement(360432..361868)
FT                   /gene="glnA1"
FT                   /locus_tag="NGR_c03210"
FT   CDS_pept        complement(360432..361868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA1"
FT                   /locus_tag="NGR_c03210"
FT                   /product="glutamine synthetase protein"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03210"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24119"
FT                   /db_xref="GOA:C3MGK4"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGK4"
FT                   /protein_id="ACP24119.1"
FT                   /translation="MSSKRSVGQQTAKVSKSSGVPLALHAPRGVKTWKEAVDWLKIRGI
FT                   EDIECITPDLAGVPRGKMMPTSKFTSNTSLALPSAIYRHTISGEYPEETGQFRYDSRDS
FT                   DIKLVPDLSTISIVPWESDPTAQVICDIVGSQGEQISYTPRNVLKRVLDLYRQKGWKPV
FT                   VAPEIEFYLVAQNDDPDYPLRPPKGRSGRSILGGQGYSIAGINEFDELIDDIYHFSEKQ
FT                   GLEIDTLIHEEGPAQLEINLRHGDPIELADQVFMFKRTIREAALKHGIYATFMAKPMQG
FT                   QPGSAMHIHQSVIDIETGRNIFSSPDGSPSKEFFAFIGGMQHYVPKTLSMMAPYVNSYR
FT                   RLTPDMSAPVNTAWGYDNRTTAFRIPVSDPVARRIENRLPSSDANPYLALAASLGCGYL
FT                   GIMEDLQPTPPSEDTANEGEIDLPRGLLEAISLLESEPSLAEVFSAEFIAIYAGVKRGE
FT                   FETFMQVISPWEREFLLLNV"
FT   gene            362087..363271
FT                   /locus_tag="NGR_c03220"
FT   CDS_pept        362087..363271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03220"
FT                   /product="predicted HI0933 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03220"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24120"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGK5"
FT                   /protein_id="ACP24120.1"
FT                   /translation="MIETQDVVIIGAGAAGMMCAIEAGKRGRRVVVIDHARAPGEKIRI
FT                   SGGGRCNFTNIHAGPKNFLSDNPHFCKSALARYRPQDFVSLVERHGIAWHEKTLGQLFC
FT                   DHSAKDIIRMLLAEMKEVGAMLRLETTISAVERTASGFRVATSAGTVDTASLVVASGGK
FT                   SIPKMGATGLAYRIAEQFGLPVVETRPALVPFTLDPAQLEKLGGLAGVAADAEVRFGKI
FT                   AFREAVLVTHRGLSGPAILQISSYWREGAEIVLRLMPDIDIASILKGMRRTGGRQAAQT
FT                   ALADILPRRLAQFFAEEAKLAGRLLADLSDKAIDALSASIQAWTLKPAGTEGYRTAEVT
FT                   LGGVDTRALDSRTMRATNIPGLYFIGECVDVTGWLGGYNFQWAWASGFAAGQDV"
FT   gene            363980..366505
FT                   /locus_tag="NGR_c03230"
FT   CDS_pept        363980..366505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03230"
FT                   /product="predicted chemoreceptor y4fA"
FT                   /note="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03230"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24121"
FT                   /db_xref="GOA:C3MGK6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGK6"
FT                   /protein_id="ACP24121.1"
FT                   /translation="MLIDRILARFKIQTKVLFFILPFVVSITAVGITGLYASGLLQGRM
FT                   EISNSVLQTLSGFKDVYAGMNQFLHETTEESRNAVLDTIAAQEQVLADTAAQVAGASGE
FT                   TELDAAIVATNDIEARIDGLWTLHEGEQKLRAATKANLEKLAAEQVKISDETNRLQYAV
FT                   RKDENAAKTMLRNAEKLMRASRFYTEFATEVSKAITVEEKVKVAQELFPRISRTQRDIF
FT                   TLLPKGEKSLAETVNSAAGGIGALIKAPAAPETLGGLAKFVDRFRNASFRLEAASVGKM
FT                   REATQIFAELDSKIAATESVLTATRRLSVSITEIQIATAAFLGNTTEENRQKLLDKFLA
FT                   VQANLTTLRGIAKDLSFFDATADVVVPIIDAMKKDGVSLVEITDKRTAEFNAAGASINE
FT                   IWNDLTGFAEQQKVAAGTEREEANQISVAATVAGVVIALLAGIALTLTLKRPIGQITAA
FT                   MRRLADGMLDTAIDGDARRDEIGDMARALGVFKENALSKVRIEAESAEERARSEAERNR
FT                   NDADKRELDRQIDVAVSELAAGLGRLAQGDLSQQIEVPFHGRLEQLRQDFNGSLIRLQD
FT                   TLAQIRGNAQAIQQGGANMHQSADALSRRTEAQAASLEQTAAAVDQITATVRSSAERAH
FT                   EANQSVSETKRSADSSATVVANAIAAMGRIEDASRQIEQIIEVIDDIAFQTNLLALNAG
FT                   IEAARAGEAGKGFAVVAQEVRELAQRSAEAAREIKGLINKSTDEVSSGSLLVKETGAVL
FT                   ASISAQIVTVSQHVDMIATASRDQATALHEVNGSVNQMDQMTQQNASMVEEATATSRAL
FT                   ATQADTLMMLVEQFRLEPENGAGQVYRAA"
FT   gene            366877..367752
FT                   /locus_tag="NGR_c03240"
FT   CDS_pept        366877..367752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03240"
FT                   /product="predicted transcriptonal regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03240"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24122"
FT                   /db_xref="GOA:C3MGK7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGK7"
FT                   /protein_id="ACP24122.1"
FT                   /translation="MKNMDWDVYRCFMTVARGGGLTGAAQATGLSPATIGRRMLELEER
FT                   TGRVLFVRSQTGYALTAEGRFLFEQLQEMEAAARKVESWQKEGEGATIIRIAAGTWGAW
FT                   LIAENFPAICTERDLFGISLSIGEARANLAYRESDIGIRAFEPEETYLASRPVGEVAYA
FT                   AYRQKNTPGGSDRWVAVAEEDALSAYLRWPHENASGRIVATVSRPRSLLDLARAGAGTA
FT                   VLPCFVGDLDPQLERAGEEIGALRHRQWIVMNNEDRHRRDIRTVVDRMTRLLRSHADLF
FT                   AGKRPRRNVA"
FT   gene            complement(367936..368175)
FT                   /locus_tag="NGR_c03250"
FT   CDS_pept        complement(367936..368175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03250"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24123"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGK8"
FT                   /protein_id="ACP24123.1"
FT                   /translation="MTVQTRVKERAEEQSSAMTPDQQAAIRMVANDLHRLNQSVMKAVE
FT                   AGVSVELVRSARHHGGGGNWGDLLIPVIVTQGRS"
FT   gene            complement(368304..368525)
FT                   /locus_tag="NGR_c03260"
FT   CDS_pept        complement(368304..368525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03260"
FT                   /product="hypothetical protein"
FT                   /note="with partial similarity to isocitrate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03260"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24124"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGK9"
FT                   /protein_id="ACP24124.1"
FT                   /translation="MWLVYAAQCKNCHMDLRASAGQGGSRGAYRFDEERSMTDFYKLAV
FT                   PAGSTGDQSSTTAMREATAHDQFGPATE"
FT   gene            368646..370055
FT                   /locus_tag="NGR_c03270"
FT   CDS_pept        368646..370055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03270"
FT                   /product="putative HTH transcriptional regulator, XRE
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03270"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24125"
FT                   /db_xref="GOA:C3MGL0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018653"
FT                   /db_xref="InterPro:IPR026281"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGL0"
FT                   /protein_id="ACP24125.1"
FT                   /translation="MAENKIFAGPRVRRIRNGLQLTQTAMAEALGISPSYLNLIERNQR
FT                   PLTVQLLLKLASVYKVDLEELQGEAGGSLAELREVFADPLLAGELPGDQELIEVTEAAP
FT                   NVSGGVVKLYRAYREQASRLKDLAELLAGQGHMASLADTRLPIDEVRETFEARPNHFAR
FT                   IEEAMEAFHASLSPGDDLPAALKAWLKREHGLVVRTLPVHVMPNLRRRFDRHSMRLFIS
FT                   ERLSPFDQTLEIAMEVASIACHEPIMAELDQFPFSAAEARRIGRFQLARYAAHALMMPY
FT                   AAFHAAAQRSKYDIDLMRARFQVSFEQAANRLTSLQRPGAAGIPFFLMEIDNAGHRLRR
FT                   AGAQGFPHARFGGACPKLNIHAAFAVPGQILVDRVEMPDGGEFLTVARTVEGPQASFQE
FT                   RVRRTALLIGCDAGFAQETVYGAARLPPIAVGPVCRLCERQGCLARAEPPVTRPLGLDE
FT                   MATGLSVFDFQ"
FT   gene            370353..371447
FT                   /locus_tag="NGR_c03280"
FT   CDS_pept        370353..371447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03280"
FT                   /product="spermidine/putrescine ABC transporter,
FT                   periplasmic substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03280"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24126"
FT                   /db_xref="GOA:C3MGL1"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGL1"
FT                   /protein_id="ACP24126.1"
FT                   /translation="MSKFIVATLAAAMLAGSATLASAQERVVNVYNWSDYIDESILEEF
FT                   TKETGIKVVYDVFDSNEILETKLLAGGSGYDVVVPTAYFLQRQIAAGVFQKLDKSKLPN
FT                   LSNMWDLILERTAKYDPGNEYAVDYMWGTTGIGYNVDKMKEILGTDAKPNWDVIFNPEI
FT                   AAKFKDCGIHLLDSPTDIIPSALAYLGLNPDSHDPADLEKAADVLLKVRPYIRKFHSSE
FT                   YINALANGDICLAVGFSGDIFQARDRAAEAKAGVTVDYSIPAQGAQMWFDMLAMPADAP
FT                   HVAEAHEFINFMMKPEVIAKASNYVFYANGNKASQQFLDREVLEDTAIYPTDDVMQKLF
FT                   TVTPFEPKEQRVLTRLWTKIVTGQ"
FT   gene            371575..372720
FT                   /locus_tag="NGR_c03290"
FT   CDS_pept        371575..372720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03290"
FT                   /product="spermidine/putrescine ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03290"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24127"
FT                   /db_xref="GOA:C3MGL2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGL2"
FT                   /protein_id="ACP24127.1"
FT                   /translation="MMKSLGSIRRSFAPWADPASKPFISVKNVTKKFGDFIAVDDLSLN
FT                   IYTREFFALLGASGCGKSTLLRMLAGFEQPTSGEIILDGQNLAGIPPYRRPVNMMFQSY
FT                   ALFPHMTVENNIAFGLKQDGMPKPEIAERVAQMLKLVKLEKFAQRKPHQLSGGQRQRVA
FT                   LARSLAKRPKVLLLDEPLGALDKKLREETQFELMDLQQDLGLTFVIVTHDQEEAMTMAD
FT                   RIAVMSHGKVVQVATPAEIYEAPNSRFVADFIGDVNLFDGTVTAAEGALVRIETTGGIP
FT                   LRMASVENLASGAKAAVAIRPEKIRISRQPPAHAPINTAEGEIWDIGYLGDMTVFHVRL
FT                   KDGKVVKASSLNAVRAVEDPLGYDQQIWISFGEDAGVVLKD"
FT   gene            372725..373636
FT                   /gene="potH"
FT                   /locus_tag="NGR_c03300"
FT   CDS_pept        372725..373636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potH"
FT                   /locus_tag="NGR_c03300"
FT                   /product="putrescine ABC transport system permease protein
FT                   PotH"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03300"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24128"
FT                   /db_xref="GOA:C3MGL3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGL3"
FT                   /protein_id="ACP24128.1"
FT                   /translation="MAKLASALVSRLVIIVPYAWLLFFFLIPFFIVFRISLSQTAVAMP
FT                   PYTPVFDLAGGLAGLLEKAREFSVDNYVWLTDDALYFNAYVSSLVIAAISTFLTLLIGF
FT                   PVAYGMAKAPRSIRPTLLMLVILPFWTSFLIRVYAWIAILKPEGLLNQFLITIGIIDQP
FT                   LIILNTNTAIYIGIVYSYLPFMVLPIYSALEKMDNALIEAAQDLGCTPTSAFWRVTFPL
FT                   SLPGVIAGCLLVFIPAVGEFVIPDLLGGSETLMIGKTLWNEFNANRDWPVSSAVAIILL
FT                   MILVIPIVYFQNVQGKADSEGK"
FT   gene            373640..374461
FT                   /gene="potI"
FT                   /locus_tag="NGR_c03310"
FT   CDS_pept        373640..374461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="potI"
FT                   /locus_tag="NGR_c03310"
FT                   /product="putrescine ABC transporter system permease
FT                   protein PotI"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03310"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24129"
FT                   /db_xref="GOA:C3MGL4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGL4"
FT                   /protein_id="ACP24129.1"
FT                   /translation="MEKWSRFNVASVVLGFGFLYLPIVLLVIFSFNESKLVTVWAGFST
FT                   KWYSQLWHNQGLLDAAWVTIRVGLLSATCATVLGTLAAIALVRYSRFRGRVLFSGMVYA
FT                   PLVMPEVITGLSLLLLFVAIGLDRGFWTITLAHITFTMCFVAVVVQSRLLSFDQSIEEA
FT                   ALDLGATPVRTFFAITLPVIAPAVFSGWVLAFTLSLDDLVISSFTTGPGATTLPMKIYS
FT                   QVRLGVTPEINAICTILIGVVALGVVVASIVTKRREVQRERDERAAIAAIG"
FT   gene            complement(374737..376662)
FT                   /locus_tag="NGR_c03320"
FT   CDS_pept        complement(374737..376662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03320"
FT                   /product="AsmA protein family precursor"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03320"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24130"
FT                   /db_xref="GOA:C3MGL5"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGL5"
FT                   /protein_id="ACP24130.1"
FT                   /translation="MAAPQPRGRHFHVSCICPPQGLSKRFHRGDADPTEMTRPIRKISR
FT                   ILRLRLRRRHFVWSAAVGVLLAMGYNAALPLLVSTTGVRATMERTLDSWSGGKSRINGE
FT                   PEVRFWPKLLLTLPSATIESTGPDPRPLAEIGRITASFSPLSALLGDPTLEDISLVDPV
FT                   ITIERRADGTTNWQTPHWLAPPEAPASGRETAFGDIAIVNGRLRVLDRTAGGNDVDIAG
FT                   ISGTIKWPSFAERLSAQLSARLRDEEIAWAIVCEEPLALFARRNASLKTSITSAPVTFS
FT                   FEGVGNLSSVPFASGHLQMSATSLATLVQWYQGTSTETLPSGGLSIDTRVTTGEKTLKL
FT                   DDLAFTMGGASATGVLDIALQDGKAPSVEGTLAFDRIDLNGVPVAALTPFGRDDRLWRL
FT                   AETFVGAWHTDIRLSSQEVLAGPLHLTEVAAGVLIDGKRASLDIGDSNYANGSLSGRVV
FT                   LSDQGLEHGGRLQARLKDANFAAVLASFGLAGPIPAGRGILNIDIGTERAVWAAGSGDF
FT                   SGNLSFSLANGSIAGFDAPAFADLVRKGEFFSLSQANEASFDFQSATVKASFANGTARL
FT                   DRADFVGPSGQLSVAGVIPYRNGSLALAGTLKTEAPTGNQPVLFFVGGSWPNAVISPLS
FT                   VLVAPK"
FT   gene            376725..378677
FT                   /gene="acsA"
FT                   /locus_tag="NGR_c03330"
FT   CDS_pept        376725..378677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acsA"
FT                   /locus_tag="NGR_c03330"
FT                   /product="acetoacetyl-coenzyme A synthetase"
FT                   /EC_number="6.2.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03330"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24131"
FT                   /db_xref="GOA:C3MGL6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGL6"
FT                   /protein_id="ACP24131.1"
FT                   /translation="MQTDRPLWVPDAETLAQSPMAEFIAWCEQRFGRRFPDYDAFHKWS
FT                   VTERGDFWTAVWEHCGVIGERGSQALINGERMLEARFFPEAKLNFAENLLRGSGGDAAL
FT                   IFRGEDKVRYRLSWDELRSLVSRLQQALKARGIGVGDRVAAMMPNLPETIALMLATASL
FT                   GAIWSSCSPDFGEQGVLDRFGQIGPKLFVVCDGYWYNGKRQDVDAKVRAVAKTLGVPTL
FT                   VVPYAGDSAGLAAAIDGGVTLPDFIAGFEARPLEFERLPFGHPLYILFSSGTTGVPKCI
FT                   VHSAGGTLLQHLKEHRFHCGLKEGERLFYFTTCGWMMWNWLASGLAVGATLCLFDGSPF
FT                   YPDGNVLFDFAAEERFAVFGTSAKYIDAVRKGDLTPATTHDLSALRLLTSTGSPLSPEG
FT                   FSFVYEGIKSDVQLASISGGTDIVSCFVLGNPLKPVWRGEIQGPGLGLAVDVWNDEGRP
FT                   VRGEKGELVCTKAFPSMPVMFWNDPEGAKYRAAYFERFDNVWCHGDFAEWTPHDGIVIH
FT                   GRSDATLNPGGVRIGTAEIYNQVEQMPEVAEALCIGQDWQEDVRVILFVRLVPGVVLTE
FT                   ELSQAIKTRIRTGASPRHVPAKIIPVADIPRTKSGKIVELAVRDVVHGRPVKNKEALAN
FT                   PEALDLFAGLDALKS"
FT   gene            complement(378945..380627)
FT                   /locus_tag="NGR_c03340"
FT   CDS_pept        complement(378945..380627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03340"
FT                   /product="ABC transporter, membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03340"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24132"
FT                   /db_xref="GOA:C3MGL7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGL7"
FT                   /protein_id="ACP24132.1"
FT                   /translation="MHSTAKSLKRHYAKPGSGLTHRLLASWSGLASAIVLMPIVAIAWL
FT                   AVTGGGADWPHLIENVIPRATMRTLMLMGLTGAATAVVGILTAWLVATCEFPLRRLLSA
FT                   ALVLPLAIPAYLAAYAFGELLTFTGPVQGLIRALFGFQTSRDYWFPDVRSLGGAVLVMS
FT                   SVLYPYIYLACRSMFLMQGRAAADVARTLGAGPLKVFMKIQIPMARPAIMIGLTLVAME
FT                   TMNDIGAVEFLGVQTLTFSIFDTWLNRGSLAGAAQIACIMLVFIVALMMVERAARRSQR
FT                   FSSQKTTAAVHDAARLELSGWKKWAATLACLLPVLSGFAVPFLVLGNYALKRLDHFLAP
FT                   RLIDALLHSVLVSSLTALAAVFLGFVLAYAARTGRSPITEVAGRLASFGYGVPGTVLAI
FT                   GVLFPLAALDNALDARMRDVFGISTGLVLSGTGFAIVYACAVRFLTMAEGTLEAGFHKL
FT                   SPHLDMAARALGRTSAQTLRSVLLPMMRPAVLTSALLVFIETMKELSATIMLRPFNFNT
FT                   LATLVYEDASRAKVEDASVAAMIIVVAGMIPVILVSRSLESRS"
FT   gene            complement(380709..384062)
FT                   /locus_tag="NGR_c03350"
FT   CDS_pept        complement(380709..384062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03350"
FT                   /product="predicted sensor histidine kinase protein with
FT                   ATP-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03350"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24133"
FT                   /db_xref="GOA:C3MGL8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGL8"
FT                   /protein_id="ACP24133.1"
FT                   /translation="MPARQYPFIDIAVHARVREHFARGDAAVLFSKDLARVLWANDQGA
FT                   RLFGVASVYDFIDGALSATDLSLRQLRAAAEQLAAVGDRRQLLIRIAAGFRRLPLNATV
FT                   EMIRIRPGEEAVLFTAPHNGKALSAEERAAAMIAGLDGPDTHMAVLDDDGEIVARSPGF
FT                   EHLGLSGDIRRTLVSAVAREKDRLIKRLVATEKGQLPAAIGKISDHPALHLLFAVETTL
FT                   DTPDAEEAAAKDEPDAIAAAAAEVGTGLPSPTTLDEPAETPLREDTSEAEATTDPAATD
FT                   EPTDAPSLGEEHGELALRSGDEAADLAPSAEAAEPAPEVATSDADSAAAAASGFTFTPG
FT                   SRAVRFVWKIDAEGCFSEISEEFAAAVGPKSADVVGLTFSELAARYDLDPDNKVNALLH
FT                   RRDTWSGKTILWPIEGTSLKVPVDLAALPTYSRSREFDGFRGFGIVRIADAVEDEKASG
FT                   LSLGHIDTPRNEGMPAEAPSDDAPREPASLASDGTDTPRSEAEPPSAEDPFAGERPALR
FT                   IVDIPARPPSDKVIDLDEHRPGSSGTLTRGEQAAFREIARQLGAQFSETTPPAAADEDG
FT                   KRPVDAASQAEAAGDMESLSSEDATAARQEETMPGAGDEAPPAPRGGVGMSSEILDRLP
FT                   VALLIHHGDELLHANPEFLRLTGYRKLEAFQQAGGLEALFAYGAESGEHEPDGTMTLVR
FT                   ANGPLAPVSAHLHSIQWEGRSALMLALAPAAARAADMPSAGADASAGGEARLRMEIDEL
FT                   RSILETATDGVVVLGQDGDIRTMNGSASALFNYDEDEMRGKPFAALFAHESQKAVIDYL
FT                   QGLSGHGVASVLNDGREAIGREAGGGFLPLFMTIGRLSSSNGYCAVIRDITQWKRTEEE
FT                   LRNAKRSAETANAHKTEFLARVSHEIRTPLNAIIGFSDMMASEHFGPIGNPRYIEYAGD
FT                   IGRSGRHVLDIVNDLLDISKIEAGEMELDFSAVDLNEAVSEAVSLVQPQANSQRVIIRT
FT                   SLSGSVPEVVADGRSIKQIALNILANAIRFTPSGGQIVVSTSYETNGSVILRIRDTGIG
FT                   MTRNELDQAMKPFRQVTTGGRKRGEGTGLGLPLTKAMAEANRAQFGISSAPNEGTLVEI
FT                   SFPSQRVLAN"
FT   gene            384382..384828
FT                   /locus_tag="NGR_c03360"
FT   CDS_pept        384382..384828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03360"
FT                   /product="hypothetical protein"
FT                   /note="similar to phasin 2"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03360"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24134"
FT                   /db_xref="InterPro:IPR010234"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGL9"
FT                   /protein_id="ACP24134.1"
FT                   /translation="MATKKTEDAFALSFDPAKFADSFRDFAEKGAAQSKDAYAKMKTAA
FT                   EEATKTVEATLESAQSGSVELGLKAINALRTNAENSLSHMEALLGVKSLSELVELQTAF
FT                   IRKQAELAVEQAKTMQEATRKVAENVAKPGKEAAEKVVSTFKKA"
FT   gene            385091..385167
FT                   /gene="trnH"
FT                   /locus_tag="NGR_c03370"
FT                   /note="tRNA-His"
FT   tRNA            385091..385167
FT                   /gene="trnH"
FT                   /locus_tag="NGR_c03370"
FT                   /product="tRNA-His"
FT                   /note="codon recognized: CAC"
FT   gene            complement(385185..386066)
FT                   /locus_tag="NGR_c03380"
FT   CDS_pept        complement(385185..386066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03380"
FT                   /product="putative LysR family transcription regulator
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03380"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24135"
FT                   /db_xref="GOA:C3MGM0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGM0"
FT                   /protein_id="ACP24135.1"
FT                   /translation="MDWDDVRVFLAVARTGQILAASKRLGINHATLSRRVTALEETLKT
FT                   RLLVRRPNGCELTAEGEIFLSAAERMETEMLAAQSQIGRIDTAIAGTVRIGAPDGFGVS
FT                   FLAPRLGRLTARHPELKLQLVPVPRSFSLSQREADIAITIERPEQGRLVSSKLTDYTLG
FT                   LYASADYLARYGTPRTIDDLKNHRRIGYVEDLIFTPSLNFSAEIMRSWDASFEISSATG
FT                   QTEAVRSSAGVGILHNYIARHYPELTRLLPDTTIRRAYWTTYHESARELVRVRTVVSFL
FT                   QELLTAEHQIFV"
FT   gene            386198..387694
FT                   /locus_tag="NGR_c03390"
FT   CDS_pept        386198..387694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03390"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.27"
FT                   /note="similar to DddC"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03390"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24136"
FT                   /db_xref="GOA:C3MGM1"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGM1"
FT                   /protein_id="ACP24136.1"
FT                   /translation="MYEVGHFIDGKRVAGKSGRVSNIFNPATGEVQGTVALASDAELAA
FT                   AVESAKAAQVKWAATNPQRRARVFIKFVQLLNDNMNELAETLSREHGKTIDDAKGDIVR
FT                   GLEVCEFVIGIPHLQKSEFTEGAGPGIDMYSIRQPVGVGAGITPFNFPGMIPMWMFAPA
FT                   IACGNAFILKPSERDPSVPVRLAELMIEAGLPAGVLNVVNGDKGAVDAILTHPDIAAVS
FT                   FVGSTPIARYVYGTAAMNGKRAQCFGGAKNHMIIMPDADLDQAANALIGAGYGSAGERC
FT                   MAISVAVPVGEETANRLIDKLTPMVESLRIGPYTDEKADMGPVVTKEAEQRIRSLIDSG
FT                   IEQGAKLVVDGRDFKLQGYEDGHFIGGCLFDHVTPDMDIYKTEIFGPVLSVVRAKNYED
FT                   ALSLPMKHEYGNGVAIYTRDGDAARDFASRINIGMVGVNVPIPVPLAYHSFGGWKSSSF
FT                   GDLNQHGPDSIKFWTRTKTITERWPSGIKDGAEFSIPTMR"
FT   gene            387858..388292
FT                   /locus_tag="NGR_c03400"
FT   CDS_pept        387858..388292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03400"
FT                   /product="putative transposase for insertion sequence
FT                   NGRIS-12a"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03400"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24137"
FT                   /db_xref="GOA:C3MBV6"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:C3MBV6"
FT                   /protein_id="ACP24137.1"
FT                   /translation="MDERSQSHATWDCKYHVVFSSKYRTKRLYGDLRRELGDLLHRLAL
FT                   QKDCRIEEGHLMPDHVHMLISIPPKYSVSHIVGFLKGKTALYVANKYARKRRYKGYHFW
FT                   ARGYFVSTAGYDEQVVRRYIRNQEKADKASDFADLFNRSY"
FT   gene            388518..389633
FT                   /locus_tag="NGR_c03410"
FT   CDS_pept        388518..389633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03410"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03410"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24138"
FT                   /db_xref="GOA:C3MGM3"
FT                   /db_xref="InterPro:IPR010295"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGM3"
FT                   /protein_id="ACP24138.1"
FT                   /translation="MVLAEPFPAQIGQGSFGRSAQGDYQRLSFTGSGKEYFGIWIVNIL
FT                   LTIVTLGIYSAWAKVRRNRYFYGNTVLLGRGFEYHARGGQILIGRLIVFAYLVVYNILL
FT                   TFVPLAGIALLLLLLCFVPWLVARGLRFSARVTSYRNVRFDFVGRAGGAFLAFIVGPVI
FT                   AALTLGILAPLASRWTYRYIGNNLRYGQKAFSTDPSIGTIYKSWAISAAIIILGLLIVG
FT                   FFAFLNFAVFVTAIESPDLIPAEMQVSIVVLVVLGYFLFFAIFGVAALVYRAGVRNVAW
FT                   SAATFDGKHRLLSDLSRLRYTWIAISNVVVTLVTLGLMRPWAAVRMARYVNEQTGVRFD
FT                   GNVGEIFSAIAQEGSAVGSEFMDIEGFDFGF"
FT   gene            389623..390678
FT                   /locus_tag="NGR_c03420"
FT   CDS_pept        389623..390678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03420"
FT                   /product="putative zinc metalloendopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03420"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24139"
FT                   /db_xref="GOA:C3MGM4"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGM4"
FT                   /protein_id="ACP24139.1"
FT                   /translation="MASDHPAIAVGEWHPAGSSRSVLSGLVEVGDRLIVRDETGADLAG
FT                   GRLSLVEISARVGRIPRRISFPDGSLFETNDNEAMDRFLAEKGRAGAGIVHRLERFHPR
FT                   LIAFVAATILLGVLIYRYALPALVEVAIAVTPPIVPRMMSASTLETMDRTLLGESKLDE
FT                   ARRGKIVDGFRRIAAVSAAGEAAYTLNFREGGPMGPNAFALPDGTLILTDELVELAGDD
FT                   SEMIVGVLAHEIGHVQHKHSLRQIYRAAGVAALIMLIAGDIGSGAEDVLVEGGGLLALS
FT                   YSRSAEAEADRHSVELMMKAGLDPAAIARFFELLETKLDDHSDTSIFSTHPGTPERRKA
FT                   ITDLIAELRKN"
FT   gene            complement(390675..391178)
FT                   /locus_tag="NGR_c03430"
FT   CDS_pept        complement(390675..391178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03430"
FT                   /product="putative acyl-CoA thioester hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03430"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24140"
FT                   /db_xref="GOA:C3MGM5"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGM5"
FT                   /protein_id="ACP24140.1"
FT                   /translation="MEETNDKSQLEMVVLMTPDMANFSGKVHGGALLNLLDRVAFSCAS
FT                   RYSKQYAVTLSVDQVVFRQPIHVGELVHFRASINFAGRTSMEVGIRVEAENIRSGERRH
FT                   TNSCYFTMVAVDAEGRPTSVPPYRPEPGVRERRYRAAEVRRELRREFEERFRAAGSTAA
FT                   SSHD"
FT   gene            complement(391364..392407)
FT                   /locus_tag="NGR_c03440"
FT   CDS_pept        complement(391364..392407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03440"
FT                   /product="extracelluar solute-binding protein, family 1"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03440"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24141"
FT                   /db_xref="GOA:C3MGM6"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGM6"
FT                   /protein_id="ACP24141.1"
FT                   /translation="MLASKTLIGTLSVAAAILAFSAPARAEGEVNIYSYRQPDLIKPLL
FT                   DAFTKETGIAANVLFLDKGLVERIQAEGANSPADVILTVDISRLTEAKDAGVTQPLVNE
FT                   TINKDIPAHFRDPDGNWFGLTTRGRVVYASKERVPQNDITYEELADPKWKGKFCTRDGQ
FT                   HSYNIGLFASMIAHHGEAETEKWLTGFRDNLSKKPDGGDRDQAKAIFAGECDIALGNSY
FT                   YVGLMLTNDKEPQQKEWASAIKVLFPNAKDRGTHVNISGMALAKNAPNKENAVKLMEFL
FT                   SEGEAQKIYAEQVFEYPVLPGAEPSDVVKSFGTIKPDSLPLAEIAANRKKASELVDKVG
FT                   YNDGPQD"
FT   gene            392594..393058
FT                   /locus_tag="NGR_c03450"
FT   CDS_pept        392594..393058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03450"
FT                   /product="putative transcriptional regulator, Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03450"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24142"
FT                   /db_xref="GOA:C3MGM7"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGM7"
FT                   /protein_id="ACP24142.1"
FT                   /translation="MRLTKQTNYAVRMLMYCAANGEKLSRIPEIAKAYGVSELFLFKIL
FT                   QPLTRAGLVETVRGRNGGVRLPKPASEISLFDVVKVTEDSFAMAECFEAGEIDCPLVDS
FT                   CGLNAALRKALNAFFDVLKGYTIDDLVKARPQINFLLGLETGPRPQTSAA"
FT   gene            393363..394958
FT                   /gene="dppA"
FT                   /locus_tag="NGR_c03460"
FT   CDS_pept        393363..394958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppA"
FT                   /locus_tag="NGR_c03460"
FT                   /product="periplasmic dipeptide ABC transport protein
FT                   precursor DppA"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03460"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24143"
FT                   /db_xref="GOA:C3MGM8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGM8"
FT                   /protein_id="ACP24143.1"
FT                   /translation="MKKLTTLFAATALATLMAGTAWSKTFVYCSEGSPEGFDPGLYTAG
FT                   TTFDAAAHTVYSRLLEFKKGTTETEPGLAESWTISDDGLEYTFKLRPGVKFQTTEFFTP
FT                   TRELNADDVIFSLERQWKSDNAWHGYVTGGSWEYFAGMGLPELLESIEKVDDMTVKIKL
FT                   KRKEAPFLANLAMPFASIMSKEYADKLQAEGKMNQLNQMPLGTGPFAFVGYQQDAVIRY
FT                   KAHPDYWGGKQKIDDLVFSITTDAAVRFQKLQAGECHLMPYPNAADVEAMKADPNLKVM
FT                   EQAGLNVAYLAYNTTQAPFDKPEVRKALNKAINKQAIVDAVFQGQATPATNPIPPTMWS
FT                   YDDTVADDTYEPEVAKKMLEDAGVKDLSMKVWAMPVARPYMLNARRAAELMQADFAKVG
FT                   VKVEIVSYEWAEYLEKSKDKARDGAVILGWTGDNGDPDNFLDTLLGCDAVGGNNRAQWC
FT                   NKEFDDLVTKAKEASDVAERTKLYQQAQAVFKKEAPWATLDHSLSIVPMRKNVEGFVQS
FT                   PLGDFAFDGVDIVE"
FT   gene            395068..396072
FT                   /gene="dppB"
FT                   /locus_tag="NGR_c03470"
FT   CDS_pept        395068..396072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppB"
FT                   /locus_tag="NGR_c03470"
FT                   /product="dipeptide ABC transport system permease protein
FT                   DppB"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03470"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24144"
FT                   /db_xref="GOA:C3MGM9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGM9"
FT                   /protein_id="ACP24144.1"
FT                   /translation="MFRFLLGRLAVLIPTFIGVSIIAFSFIRLLPGDPVALLSGERVMS
FT                   PERHAEISHQLGFDRHIVVQYLDYLWGVLQGDFGISIVTKKPVIDQFLELFPATVELSL
FT                   CAIIFAVVVGIPAGVIAAIKRGSILDQLIMGTALVGFSMPIFWWGLLLIIVVSGILQWT
FT                   PVSGRISLMFFFPSVTGFMLIDSLLSGQDGAFRSAFSHLILPTIVLGTIPLAVIARQTR
FT                   SAMLEVLSEDYVRTARAKGLPTFRVVGIHALRNAMIPVVTTIGLQIGVMLAGAILTETI
FT                   FSWPGIGKWMVDSVFRRDYAVIQGGLLIIAAVIMLVNLAVDLLYGLINPRIRH"
FT   gene            396083..396991
FT                   /gene="dppC"
FT                   /locus_tag="NGR_c03480"
FT   CDS_pept        396083..396991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="NGR_c03480"
FT                   /product="dipeptide ABC transport system permease protein
FT                   DppC"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03480"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24145"
FT                   /db_xref="GOA:C3MGN0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGN0"
FT                   /protein_id="ACP24145.1"
FT                   /translation="MTEVTATSPISTDPSRRARLAEFWYYFSENRGAVIGLFFFLFLVV
FT                   LALCAPLVAPHDPTVQFREAVLLPPFWQEGGRLEFLLGTDAVGRDMLSRLIYGTRFSLF
FT                   VGVIVTTLSLVGGILVGVVAGYFRGWVDTFIMRIMDIILAFPSLLLALVLVAVLGPGLT
FT                   NAMIAIALVFQPHFVRLTRAAVMTEKTRDYVVAAKVAGAGHLRLMFRTILPNCMAPLIV
FT                   QATLSFSSAILDAAALGFLGMGAQPPTPEWGTMLAEAREFILRAWWVVTLPGLAILLTV
FT                   LAINLMGDGLRDALDPKLKRS"
FT   gene            396993..397847
FT                   /gene="dppD"
FT                   /locus_tag="NGR_c03490"
FT   CDS_pept        396993..397847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppD"
FT                   /locus_tag="NGR_c03490"
FT                   /product="dipeptide ABC transporter ATP-binding protein
FT                   DppD"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03490"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24146"
FT                   /db_xref="GOA:C3MGN1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGN1"
FT                   /protein_id="ACP24146.1"
FT                   /translation="MALLEIENLVVEFQTATGPFRAVDGVSLKVHEGEVLAIVGESGSG
FT                   KSVSMLAAMGLLPWTAKVTADKLAFNGRDLLKMPAAERRKIVGKDIAMIFQEPIASLNP
FT                   CFTVGFQIEEVLRIHMGLNRAARRRRAIELFQAVGIPDPAERLGHYPHQMSGGQCQRVM
FT                   IAIALACNPKLLIADEPTTALDVTIQKQILDLLMKLQQEYRMGLIMITHNMGVVAETAD
FT                   RVVVQYKGRKIEEADVLSLFEAPKSNYTRALLAALPENATGDRLPTISELFNEQQTLEG
FT                   AAR"
FT   gene            397844..398671
FT                   /gene="dppF"
FT                   /locus_tag="NGR_c03500"
FT   CDS_pept        397844..398671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppF"
FT                   /locus_tag="NGR_c03500"
FT                   /product="dipeptide ABC transporter ATP-binding protein
FT                   DppF"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03500"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24147"
FT                   /db_xref="GOA:C3MGN2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGN2"
FT                   /protein_id="ACP24147.1"
FT                   /translation="MTHVLEARNLVRDYHIPGSLFRKARTVHALKGVSFAVDEGKTLAI
FT                   VGESGCGKSTLGRIITLIDPATAGELLIDGKKVDIARDGLTSEMRRKVQIVFQNPYGSL
FT                   NPRQKIGDILAEPLVINTKVPAGERRDRAMTMLKKVGLEEKHYNRYPHMFSGGQRQRIA
FT                   IARALMLNPKLLVLDEPVSALDLSVQAQVLNLLADLQDEFKLTYVFISHDLSVVRYIAD
FT                   DVMVMYYGEAVEYGSRDEVFSNPQHSYTKTLFAATPRADVASIKARLARRNAA"
FT   gene            398851..399195
FT                   /locus_tag="NGR_c03510"
FT   CDS_pept        398851..399195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03510"
FT                   /product="putative endoribonuclease L-PSP family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03510"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24148"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035709"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGN3"
FT                   /protein_id="ACP24148.1"
FT                   /translation="MEIKRFETGPRMSQAVVYNNTVYLAGQVGNAGDDVVTQTKQALAE
FT                   VDRLLALAGTDKTRILSATVWLADMADFAKMNSVWDAWAPQGHTPARATGEAKLATPEY
FT                   LVEVIVTAAV"
FT   gene            399338..399508
FT                   /locus_tag="NGR_c03520"
FT   CDS_pept        399338..399508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03520"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24149"
FT                   /db_xref="GOA:C3MGN4"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGN4"
FT                   /protein_id="ACP24149.1"
FT                   /translation="MLYWLPRLCLLLIAGVVLGFGLFPRTSEDVAYTLLIILVGLGLLS
FT                   VTLHIFPPEEH"
FT   gene            399663..400787
FT                   /locus_tag="NGR_c03530"
FT   CDS_pept        399663..400787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03530"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03530"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24150"
FT                   /db_xref="GOA:C3MGN5"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGN5"
FT                   /protein_id="ACP24150.1"
FT                   /translation="MDSKVVAAVRSRKRSAEKELALAQATTAARKRDGMDLVVAWSVVG
FT                   LFVVACSAVVYAMAAILMPIAFAIVVGIVLGRAADELARFGLPPMLGGLLLALFFVLGL
FT                   SSLVNTLLGPITELAREAPKLAESVVERVLPFIERFEWGRIALARSVGADAFADVVVKN
FT                   AGPILGAAAASVTPALIQTLIFLAALVLFLLGRVQLRSTIILAFPSRDGRLSAIRIMNA
FT                   IEDGLTRYFSTASLIYLALGGFTMMIALVGGLPMPPLWGLFAFVSSFIPYLGVTFMTLS
FT                   LLVGGLMTHEALVVALAPATAFFLIHLAMENLVVPAILGRRFEVNPFLIFVAILFWTWM
FT                   WGAVGAILAMPLSLIAMTIFEQLREPPPEPQLPG"
FT   gene            complement(400792..401589)
FT                   /locus_tag="NGR_c03540"
FT   CDS_pept        complement(400792..401589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03540"
FT                   /product="predicted two-component signal transduction
FT                   response regulator, contains receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03540"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24151"
FT                   /db_xref="GOA:C3MGN6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR014605"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGN6"
FT                   /protein_id="ACP24151.1"
FT                   /translation="MSLSTRIAPHLPYLRRYARAVTGSQAAGDAYVAAVLEALIEDISL
FT                   FPSASNDRISLYKLFCSLFDKLKVDRSHLSSPFAWEKRAAANLSLIAPTPRQAFLLISV
FT                   EGFSSGEAAEIMSIDQGAFAKLLSSASEEISRQVATDIMIIEDEPLIAMDIEDMVTSLG
FT                   HRVTGIARTHREAIDIYRQTSPKMVLADIQLADGSSGIDAVNDILTQAAVPVIFITAFP
FT                   ERLLTGNKPEPAFLVTKPFNPEMVKALISQALFFDEQAHAASR"
FT   gene            401762..401953
FT                   /locus_tag="NGR_c03550"
FT   CDS_pept        401762..401953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03550"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24152"
FT                   /db_xref="InterPro:IPR041649"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGN7"
FT                   /protein_id="ACP24152.1"
FT                   /translation="MNDRSDGRARGISAAGARKNDANGVIASRLRALYQAIESEPVPQQ
FT                   FIDLLRRLDEAERAQSGD"
FT   gene            complement(402058..402306)
FT                   /locus_tag="NGR_c03560"
FT   CDS_pept        complement(402058..402306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03560"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24153"
FT                   /db_xref="InterPro:IPR027367"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGN8"
FT                   /protein_id="ACP24153.1"
FT                   /translation="MKKILLVVSVILPLAACTQTEKGAAIGAASGGIIGGAISNDVRGA
FT                   AVGAAVGGVAGALIGRASEPGYCVYRDRYGRRYTARC"
FT   gene            complement(402679..402873)
FT                   /locus_tag="NGR_c03570"
FT   CDS_pept        complement(402679..402873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03570"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24154"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGN9"
FT                   /protein_id="ACP24154.1"
FT                   /translation="MKMPSRHILKTVTEIGRREADVSIHNLHIGRTLRDLEMHTEEKRN
FT                   ERLQVLLDNLEQSERRLRD"
FT   gene            403186..403350
FT                   /locus_tag="NGR_c03580"
FT   CDS_pept        403186..403350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03580"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24155"
FT                   /db_xref="GOA:C3MGP0"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGP0"
FT                   /protein_id="ACP24155.1"
FT                   /translation="MLYYALIFLVVAIIAGVLGFGGIAGTSAGIAQILFFLFLIFLVVS
FT                   LVMGLFRRT"
FT   gene            403571..404824
FT                   /locus_tag="NGR_c03590"
FT   CDS_pept        403571..404824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03590"
FT                   /product="FAD dependent oxidoreductase"
FT                   /EC_number="1.4.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03590"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24156"
FT                   /db_xref="GOA:C3MGP1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGP1"
FT                   /protein_id="ACP24156.1"
FT                   /translation="MKTDVVVLGAGIVGISSAIHLARRGKSVVLLDRRGAGEETSYGNA
FT                   GLIQREGVFPYGFPHDFGALFRYALNNTIDASYHFRALPSLVPFLARYWWHSGFTRHQR
FT                   IAHLYAPLIENSIAEHSDLIDASGAGDLVRKDGWMKVFRTEKERDAAYKDAEKLSAGFG
FT                   VNHQKLSTSELKAIEPSIQVELAGGLRWSDPWSIRDPHSLNKAYLGYFQSLGGRLVSGD
FT                   AATLEHILEGPGWRVATPDGPLETREVVVALGPWADTVTRKLGYHFPLAVKRGYHMHYG
FT                   TKDGAQLNNWVLDEEMGYFLAPMLRGIRLTTGAEFALRDAPKTPVQLTRAERVAREFFP
FT                   LAERRDDEPWLGARPCTPDMMPIIGKAPRHEGLWFAFGHAHHGMTLGPVTGRALAEAMT
FT                   GEKTVIDLAPYRPHRFLA"
FT   gene            404979..405224
FT                   /locus_tag="NGR_c03600"
FT   CDS_pept        404979..405224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03600"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24157"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGP2"
FT                   /protein_id="ACP24157.1"
FT                   /translation="MNRQTIEFAGEAVGALMPDNGQLRFVAVKYSVWSLDGRIFSTAEE
FT                   ALRAVAALHVLRQRGPVGAAPVPTGPDEAFISAGSA"
FT   gene            complement(405399..405962)
FT                   /locus_tag="NGR_c03610"
FT   CDS_pept        complement(405399..405962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03610"
FT                   /product="hypothetical transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03610"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24158"
FT                   /db_xref="GOA:C3MGP3"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGP3"
FT                   /protein_id="ACP24158.1"
FT                   /translation="MDQILADILVSTRTPYPVIFARLCGAIVLGALIGIEREKRQRPAG
FT                   LRTHILVSLASAIFAVVAVESVHMTSLSGPEVRIDPIRVVEAVTAGVAFLAAGMIVFSK
FT                   GEVKGLTTGAGMWLAGAVGISVGFGFWMIATFAAVASLIVLFILGRMEVALQWKEPEGE
FT                   GNGARETGRHPAPGAPAGSDDGSR"
FT   gene            complement(406056..406442)
FT                   /locus_tag="NGR_c03620"
FT   CDS_pept        complement(406056..406442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03620"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24159"
FT                   /db_xref="GOA:C3MGP4"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGP4"
FT                   /protein_id="ACP24159.1"
FT                   /translation="MDPQDQLKERPPVDPVTGQPAPPPEVHEARASRSSWPLLVILLAG
FT                   LVLALIAWLPAELTRDAEDTPTSSTTTTQPATDEPATGTEATPPAGGTTQEPAPAAPET
FT                   QPQPTPPAPAPEGTAPQPQTPPAQ"
FT   gene            406728..407873
FT                   /locus_tag="NGR_c03630"
FT   CDS_pept        406728..407873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03630"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24160"
FT                   /db_xref="GOA:C3MGP5"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGP5"
FT                   /protein_id="ACP24160.1"
FT                   /translation="MKMTTAYETGTFVGRAWRPDVEGPSLVTVRDGELIDITSKRVPTM
FT                   RDLLDLSDPVAHARSASGEAIASVDAVMARPAGGSDEVHLLAPCDLQAVKACGVTFARS
FT                   MIERVIEERAAGDATRAETIRARMTAIIGDSLRNLKAGSPEAAGVKAALIDEGVWSQYL
FT                   EVGIGPDAEVFTKAQPLSSVGWGAAVGLHPISRWNNPEPEIVLAVSADGRIKGATLGND
FT                   VNLRDVEGRSALLLGKAKDNNASCAIGPFIRLFDETYSIDDVRHADLDLLIEGPDGFHL
FT                   KGASTMREISRDPLDLVAQTIGSHHQYPDGLMLFMGTLFAPVEDRGEPGQGFTHKIGDV
FT                   VTISSPALGSLVNTVRLSTDCPPWTFGTAALMRNLAKRGLL"
FT   gene            407934..408326
FT                   /locus_tag="NGR_c03640"
FT   CDS_pept        407934..408326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03640"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24161"
FT                   /db_xref="InterPro:IPR014587"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGP6"
FT                   /protein_id="ACP24161.1"
FT                   /translation="MDRRGLGVEMKVAIGLAAASLFVAVAAHPLRAEPLRSVDEVSEAL
FT                   GKCWTPPAGIKGSFVTLKFGFRGNGTLMGPPQPTAIRVTGDADQREAFVAAATEALEKC
FT                   MPLEFTQELAGEIAGNVFTLQFFSAD"
FT   gene            408527..411484
FT                   /locus_tag="NGR_c03650"
FT   CDS_pept        408527..411484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03650"
FT                   /product="hemolysin-type calcium-binding repeat-like
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03650"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24162"
FT                   /db_xref="GOA:C3MGP7"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013858"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGP7"
FT                   /protein_id="ACP24162.1"
FT                   /translation="MSKKVKSIAPPQASLALDPLAAAYTIPGVGDQTVNGDDASNSIST
FT                   GSGLDTINGGLGADTIRAGTGDDEILNMNVEALVGDQIDGGLGFDELGIDFSGSSKGVS
FT                   FTAFDPIVSKAVLGATIVNVERFELEGSNFADSFTGGRWDDWFEGGAGDDVLNGGIGKD
FT                   WLSGDGGSDRIYGGNGGDSVLGGAGDDYLSGGYGVDWLSADEGNDTLLGGAGGDYLYGH
FT                   SGNDNIKGESGTDTISGGSGRDTIDGGSEDDYLAGDGDNDTVLGGAGNDTIRHNMESWA
FT                   NDGKDVLDGGIGHDEVVLVGLSGTFTAKSSATKQTLSNGTTIVNFEAYTINGSETADRF
FT                   TGWTGADTLSGYSGNDTLIGLAGNDHLDGGLGSDILDGGDGNDLLIVGSGGKDVIKGGT
FT                   GYDTIWIDRSDGTTGLTFTVSGTTAKLSDGTVVTDGESFRIETGSGSDIISAGTAGYLS
FT                   IDAGSGNNRLTGGKGGDSFYSTSGSDTVSGGDGDDRIADYGGGTNKLDGGNGNDSVSAE
FT                   TETGTALTTMLGGAGSDSLSVNYGGGSTAGRFSVDGGSGTDTLWISRYDSTKNLTFVLS
FT                   ANATLVNGDVTVKNIEKINFTSGQGHDTLTAGSLDDDLNGMGGNDTLKGLGGDDDLTGW
FT                   TGADTLYGGDGNDGLWGSGGIKDTSADRLHGEKGNDVLNVNAGDYASGGDGFDRLVIEF
FT                   GEETFDVSFVFGNGLVKVNANTSFTGMEALEYVGGSGKDAVTGSAQIDYLDGGLGNDTL
FT                   RGGGGNDYLIDGRGNDRLYGDAGNDTFDRFSDGTGTDHFDGGSGVDTLEFDIISDQSVI
FT                   VDLENSARNGGVATGLTLVSIENVVGQNTDDTILGNGVANTLKGGMGDDRLDGRAGNDK
FT                   LEGGAHGDLLTGGTGADQFIYASGDAIGSGDQITDFKRGEDKLVIDKGVFHFSNLVLYS
FT                   GTDLKATGTAAQFFFEKDNGRLWYDADGTGNEADAVLVATLDKVTSLATTDFLLT"
FT   gene            complement(411567..411875)
FT                   /locus_tag="NGR_c03660"
FT   CDS_pept        complement(411567..411875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03660"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03660"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24163"
FT                   /db_xref="GOA:C3MGP8"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGP8"
FT                   /protein_id="ACP24163.1"
FT                   /translation="MLRHADNSKGTPAAGSVSDAAPAGITATDVAADWLSLAAAPTFAI
FT                   MALLAGVLGGPADMLCSSAGDAPAITGMVPMYVLMSAFHSAPWLRLISGQRRPACRS"
FT   gene            complement(411882..412679)
FT                   /locus_tag="NGR_c03670"
FT   CDS_pept        complement(411882..412679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03670"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24164"
FT                   /db_xref="InterPro:IPR010296"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGP9"
FT                   /protein_id="ACP24164.1"
FT                   /translation="MTEHRTGTREEWLAARLELLEAEKELTRRSDALARQRQALPWVRI
FT                   DKDYRFETDAGSASLRELFRGRSQLLVYHFMFGPDYTAGCPSCSAIADGFDGIVVHLEN
FT                   HDVAFSAISRAPLDKLEAYKRRMGWSFPWASSNDGDFNRDFSVWFTADEQRQGRIEYNF
FT                   RREPPAPEPLAGKTVQEWQLRGSEGPVAQIAAMTGTDVATYTRDRPGLSAFVLDDGVVY
FT                   HSYSSYARGLDGLWGMYQWLDRAPLGRNETGVWWRRNDEYGQG"
FT   gene            412774..413991
FT                   /locus_tag="NGR_c03680"
FT   CDS_pept        412774..413991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03680"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24165"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGQ0"
FT                   /protein_id="ACP24165.1"
FT                   /translation="MDSLITAAARALATGDPLGALKRVALRDDPPALALRGIAMAQLGD
FT                   FARAKVLLKNATRAFGPKEAVARARCVVAEAEIALVSRDLSFPAKALDAALATLEKHRD
FT                   WVNAAHARNLEVRRLLLVGRLDGAERALADIDPAPLPPASRAAYELAVAGIAIRRLRTK
FT                   AARAALARAGQAAREANIPALAAEVESASLVLETPAARLIAQGEARPLLLEEVEALLAS
FT                   QALVVDACRHVLRGEGTVVSLETRPVLFALARALAEAWPGDVPRGTLVARAFRAKHADE
FT                   SHRARLRVEIGRLRAELATLAEVRATKRGFALAPRAGEVVVLAPPVEGQHAAVLALLAD
FT                   GEAWSSSALAIALGASPRTVQRALEALAASDQVRSFGLGRARRWMTPPVPAFPTILLLP
FT                   GPLPGD"
FT   gene            414034..414666
FT                   /locus_tag="NGR_c03690"
FT   CDS_pept        414034..414666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03690"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24166"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGQ1"
FT                   /protein_id="ACP24166.1"
FT                   /translation="MKYSQAEILREYGPFPGADNVHGVTFDGEHVWFASGDKLNAFDPA
FT                   TGETVRAIDVAAHAGTAFDGRHLYQIAEDRIQKIDPKTGRVLSTIPAPGAGGDSGLTWA
FT                   EGTLWVGQHRGRKIHQIDPETGAILRTIESNRVVTGVTWIDGELWHGTWEDDASEVRRV
FT                   DPATGKVLETLEMPEGIGVSGLESDGGDRLFCGGGKSGKVRVVKKPR"
FT   gene            414786..415268
FT                   /locus_tag="NGR_c03700"
FT   CDS_pept        414786..415268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03700"
FT                   /product="putative transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03700"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24167"
FT                   /db_xref="GOA:C3MGQ2"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGQ2"
FT                   /protein_id="ACP24167.1"
FT                   /translation="MSVAFTKEESAETASETLLPDRPISPHPNLVTKAGLKALESQLRQ
FT                   AREGYSAASAIEDANERRRQAAGPLRDLRYFAERVRTAQLVPDPTSGETVAFGSTVTFS
FT                   RDDGRVQTYRIVGEDEADPKLGSISYVSPVARILLGKANGEVVSIGDQELEIVAIS"
FT   gene            complement(415368..415441)
FT                   /gene="trnQ1"
FT                   /locus_tag="NGR_c03710"
FT                   /note="tRNA-Gln1"
FT   tRNA            complement(415368..415441)
FT                   /gene="trnQ1"
FT                   /locus_tag="NGR_c03710"
FT                   /product="tRNA-Gln"
FT                   /note="codon recognized: CAG"
FT   gene            416002..417312
FT                   /locus_tag="NGR_c03720"
FT   CDS_pept        416002..417312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03720"
FT                   /product="putative Ppx/GppA phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03720"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24168"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGQ3"
FT                   /protein_id="ACP24168.1"
FT                   /translation="MPAAASGAAAAHETSITDKKGQKRSKKARQRRGLQGRPLTSGGKP
FT                   LAAERPADSQRLRETSVAPQPPRKDDVRAPYLAPSEPPVPLYAALDLGTNNCRLLVAQP
FT                   TRPGQFRVVDAFSRIVRLGEGLGASGRLSDDAMERSVEALKICAGKLNARSIRRRRLIA
FT                   TEAARAAENGAIFMKRVAEETGLDLEIIDRETEARLAVSGCSSLVDRETKSVVLFDIGG
FT                   GSSEIAVIRIGDNRSSRLANHITHWTSLPVGVVTLSERHGGEHVTPQSFETMVREVEGM
FT                   LDRFDGPSVEALESASGSGFHLIGTSGTVTTLAGVHLDLPRYDRRRVDGLWLSDDEVSA
FT                   MQARLLSWDFAARAANPCIGPDRADLVLAGCAILEAIRRRWPSTRMRVADRGLREGLLT
FT                   DMMADDGAWRRGRPRRHQRGSTQAGDERQRSHEGNKA"
FT   gene            417309..418046
FT                   /gene="ftsJ"
FT                   /locus_tag="NGR_c03730"
FT   CDS_pept        417309..418046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsJ"
FT                   /locus_tag="NGR_c03730"
FT                   /product="putative ribosomal RNA large subunit
FT                   methyltransferase J"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03730"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24169"
FT                   /db_xref="GOA:C3MGQ4"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MGQ4"
FT                   /protein_id="ACP24169.1"
FT                   /translation="MTKSPIGGNRSGRKLGQKVKKGKLKASSRRWLERHINDPYVQRAQ
FT                   LEGYRARAAFKLLEIDEKHKILAGARRIIDLGAAPGSWSQIAAKVTNSTDADPRVAAID
FT                   FLEMDPIPGVRFLQLDFLDPEAPEKLKEAIGGTPDLVLSDMAAPTTGHRQTDHLRTMHL
FT                   CEVAAHFAVDVLAKGGHFLAKTFQGGTERDLLNMLKQNFSQVIHVKPASSRTESVEMFL
FT                   LAKGFKGRRKAETEEPAEDAAAE"
FT   gene            418050..418433
FT                   /locus_tag="NGR_c03740"
FT   CDS_pept        418050..418433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03740"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24170"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGQ5"
FT                   /protein_id="ACP24170.1"
FT                   /translation="MLLYVTVGTNDLERAGAFYDAVLPTLGYRRQRQDETEIGYGADGD
FT                   VRVRFWVVTPFNREPATYGNGVSIALAAETRGAVDAFHAAALAAGGADEGAPGLRPFHA
FT                   HFYGAWVRDLDGNKIAAVCERPE"
FT   gene            complement(418979..420529)
FT                   /locus_tag="NGR_c03750"
FT   CDS_pept        complement(418979..420529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03750"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03750"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24171"
FT                   /db_xref="GOA:C3MGQ6"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGQ6"
FT                   /protein_id="ACP24171.1"
FT                   /translation="MRRQARSSGLDRKGQPDHRLLICNRRFCPDKATGTVYRTPTPHPE
FT                   PLMNRIVPMILAVALFMEQMDSTVISTSLPAIAHDIGVGPITLKLALTAYMVALAIFIP
FT                   LSGWMADRFGAKRIFRAAMLVFIAGSVFCAAADSLLSFVLSRFLQGMGGAMMTPVARLV
FT                   LVRGTPRSELVSAMALLTIPALVGPLAGPPLGGFITTYFSWHWIFLINVPVGIAGYVLS
FT                   GIYLPEMERHNPPPVDILGFLLGGIAASGIVFGLSVISLPALPPAVGIASVSAGVAATF
FT                   LYIFHARRHAAPVLDLRLFRDSAFRAASIGGTVFRISVGAVPFLMPLMLQIGFGLNPFQ
FT                   SGLITFIGAVGAITTKFLARRVLAFAGFRTTLIIAAVIAAATTFTNGFFTPATPYLVMI
FT                   SILLIAGFARSFFFTSVNALSFADIDDADASKATSMSAVLQQISLALGVAVAGAILEIQ
FT                   TAIGGGPLALEDFHIAFMIIAVANVLAAIPFLTMAKNAGASVSGHRKALREAEATAGK"
FT   gene            420401..421549
FT                   /locus_tag="NGR_c03760"
FT   CDS_pept        420401..421549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03760"
FT                   /product="metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03760"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24172"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGQ7"
FT                   /protein_id="ACP24172.1"
FT                   /translation="MRGRRPVDGSGGFVGAKPAIADQKPVIRLTFSVKAATSCLPAHDS
FT                   RGSANQQERSMITQNLKRRTLFGAGAAALAAPGLLTGIANAQESAEKDAMTKDAALKTF
FT                   RLGTFKVTVISDGTRASDNPHETYGTNQPAEAVTALLEQNFLPGSGFINGFSPVLVDTG
FT                   SEIVLFDTGLGEGGRAAGTGKLADGIRAAGYTPEQVSVIVITHMHGDHIGGLTEGGKPA
FT                   FANARYVTGQVEFDFWKDAARVGTPAENGHKAVLAKVAPLAEKTTFIADGVEVVPGIAA
FT                   IAAFGHSPGHMIYRLESEGKALILTADTANHYVLSLQRPDWEVRFDMDKAAASATRRKV
FT                   FDMIATDRLPFIGYHMPFPAVGFVERQDQGYRFVPATYQFDI"
FT   gene            421698..423242
FT                   /locus_tag="NGR_c03770"
FT   CDS_pept        421698..423242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03770"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03770"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24173"
FT                   /db_xref="GOA:C3MGQ8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGQ8"
FT                   /protein_id="ACP24173.1"
FT                   /translation="MVPGDFRIFEEELAMARIIETATGLEALTFDDVLLQPGHSEVMPG
FT                   QTNIATRIAQDIDLNLPILSAAMDTVTEARLAIAMAQAGGIGVIHRNLTPAEQAEEVRQ
FT                   VKKFESGMVVNPVTIGPDATLADALSLMKAHGISGIPVVENGGSGGQTQGRLVGILTNR
FT                   DVRFASDPSQKIYELMTRENLVTVKESVDQQEAKRLLHKHRIEKLLVVDPDGRCVGLIT
FT                   VKDIEKSQLNPNASKDSQGRLRAAAAVSVGDDGLERAERLIDAGVDLIVVDTAHGHSQR
FT                   VLDAVARVKKMSNSVRIMAGNVATADGTKALMDAGADAVKVGIGPGSICTTRIVAGVGV
FT                   PQLAAIMAAVEAAQASGIPVIADGGIKYSGDLAKAIAAGASAVMVGSLLAGTEESPGEV
FT                   FLYQGRSFKAYRGMGSVGAMARGSADRYFQAEVRDTLKLVPEGIEGQVPYKGPVGGVLH
FT                   QLAGGLKASMGYVGGATIKDYQQRATFVRISGAGLRESHAHDVTITRESPNYPGGA"
FT   gene            423324..423740
FT                   /locus_tag="NGR_c03780"
FT   CDS_pept        423324..423740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03780"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24174"
FT                   /db_xref="GOA:C3MGQ9"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGQ9"
FT                   /protein_id="ACP24174.1"
FT                   /translation="MSGFEIFWPVVAHVGLVFMLYALLSLRRSAVVRAGKAEASQFREN
FT                   RGEPSESLVVRNSIANQFELPTLFHVCCVLCFVTEADSLLAVGLAWIFVGFRYAHAFVH
FT                   VTSNRLRYRGPLFLAGFVTLGAMWAWLALWMAMN"
FT   gene            423828..424910
FT                   /locus_tag="NGR_c03790"
FT   CDS_pept        423828..424910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03790"
FT                   /product="alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03790"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24175"
FT                   /db_xref="GOA:C3MGR0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGR0"
FT                   /protein_id="ACP24175.1"
FT                   /translation="MWRAPPLDFLRRPSEEEIDMTGTMKAAVVREFGKPLVIEELPIPQ
FT                   PGPGQVLIKYEATGVCHTDLHAAKGDWPVRPNPPFIPGHEGVGYVAKLGAGVTRLKEGD
FT                   RVGVPWLHTACGCCTPCRTGWETLCGSQQNTGYSVDGTFAQYGLADPDFVGTLPAKLEF
FT                   GPAAPVLCAGVTVYKGLKETEVRPGEWVLVSGIGGLGHMAVQYAKAMGMHVAAADIFPD
FT                   KLALAEKLGADLVVDAKAADAIEEVQKRTGGVHGALVTAVSPKAMEQAYRMLRSKGTMA
FT                   LVGLPPSQICLPVFDTVLKRITVRGSIVGTRQDLEEALEFAGEGKVGAHFSWDKIENIN
FT                   AIFERMEEGKIDGRIVLDLN"
FT   gene            425034..425909
FT                   /locus_tag="NGR_c03800"
FT   CDS_pept        425034..425909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03800"
FT                   /product="putative dienelactone hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03800"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24176"
FT                   /db_xref="GOA:C3MGR1"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGR1"
FT                   /protein_id="ACP24176.1"
FT                   /translation="MNKPVITQAMIDAYDEYTHLTLDRRRFMERLTALAGTAAAAAAIA
FT                   PLLAANSAKAEMVAATDERIKGEDITYPGADGEMKGYLVKPANASGKLPAVIVIHENRG
FT                   LNPHIKDVARRVALDGFVALAPDFLSPDGGTPEDEDKAREMISALDAGETNANAVATVA
FT                   FLKGHAESTGNVGAIGFCWGGGMVNRLAVNSPDLKAGVAYYGSQPKAEDVPKIKAAMLL
FT                   HYAGLDERINAGIDAYRKALTENGKDATIYVYDGVNHAFNNDTSAARYDKAAAELAWGR
FT                   TVEFLKTKLA"
FT   gene            complement(425950..426861)
FT                   /locus_tag="NGR_c03810"
FT   CDS_pept        complement(425950..426861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03810"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03810"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24177"
FT                   /db_xref="GOA:C3MGR2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGR2"
FT                   /protein_id="ACP24177.1"
FT                   /translation="MLTLRQMRYFDALATARHFGRAAELAHVSQPALSAQIMEMEEHLG
FT                   VKLVERSRGGVFLTAKGEDVLTRVRAILADVDRLEESARANSGTLDGRVRLGVIPTLAP
FT                   YLVPQLIPYLRARYAAIEIELKESLTDRLIADLGDGRLDAVVAALPIDADGIAARPLFS
FT                   DRFFMAVADNDRKVLMSPLTEAQVDISQLLLLEEGHCLRDQALAVCNSAGKRQLMSFGA
FT                   TSMATLLQMVANGMGMTLIPEIAIPSEAARNAIRIVPFAEPGPAREIGLIWRRSNPRRR
FT                   DMEALGEAIVDCARSILKGAER"
FT   gene            complement(427033..427983)
FT                   /locus_tag="NGR_c03820"
FT   CDS_pept        complement(427033..427983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03820"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03820"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24178"
FT                   /db_xref="GOA:C3MGR3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGR3"
FT                   /protein_id="ACP24178.1"
FT                   /translation="MSAPLDIDQLQTFVAIADTGSFTKAADRVFKTQSAVSMQMRRLEE
FT                   RIGKPLFIKDGRGNRLTVEGDRLLNFARRMLRLNNEAIASFDDNRLEGTLRIGTPDDYA
FT                   DRYMPEIIVRFAKTHPNVELYIVCEPSADLAEKMAKGDLDIALVTHNPRVRASDVVRTE
FT                   PLCWVSSINHPLPENAPIPLAVGRRDCLWRQAACAALDATGREYQILFTSWSSTVVAAA
FT                   VLAGMAVSVLPESALRPGMKVLTLADGFPALAPVQIGIMKRPGLSPSLSNAITNHITAC
FT                   LDNITPIAVNDDLDNDIKGFPRYPRLRQSHMLPGW"
FT   gene            428188..428484
FT                   /locus_tag="NGR_c03830"
FT   CDS_pept        428188..428484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03830"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03830"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24179"
FT                   /db_xref="GOA:C3MGR4"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGR4"
FT                   /protein_id="ACP24179.1"
FT                   /translation="MRTTQHALDLDLAAGKPSLASRTAGVIGVLTAVWRLYRSRCQIAR
FT                   LHDLDDRQLLDMGLKREDLHEAMTSSFFENPGSFLTRASRNRANHFYRGVRHD"
FT   gene            complement(428857..429675)
FT                   /locus_tag="NGR_c03840"
FT   CDS_pept        complement(428857..429675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03840"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24180"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGR5"
FT                   /protein_id="ACP24180.1"
FT                   /translation="MAPLFDMFAQAQNGQAIELMAKQFGLAQDQMAKATAALMPAFSTG
FT                   FKRNTANPYDFGALLTALSTGNYVKYFEDMRQAFTPEGVSDGNDILGQLFGSKEMSRAV
FT                   AAQAAQMTGIGQEVYKQMLPVMASTLMGGLFKETTNQVNEALASNPMMTLMRQWMEATG
FT                   LAKKPEPAPNPFENPFTQAMQGFFGAGRSQETPKTPDFFAGNPFFKAYQDMMRGSSAAT
FT                   EKPPQENPAFAQFSQMMNNMFDTGLGMQKEYQKNIDALFESYKSGSGGKG"
FT   gene            complement(429776..431149)
FT                   /locus_tag="NGR_c03850"
FT   CDS_pept        complement(429776..431149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03850"
FT                   /product="glutamate-cysteine ligase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03850"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24181"
FT                   /db_xref="GOA:C3MGR6"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011556"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR035434"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGR6"
FT                   /protein_id="ACP24181.1"
FT                   /translation="MARDTTDQTPVTSVAELTAYLASGSKPKERFRIGTEHEKFAFFKA
FT                   DNSPVPYFGEASIQALLKGMAERNGWEPIVDEGNIIGLAERDGNGAISLEPGGQFELSG
FT                   APLENLHQTCKESNQHLAVLREIAEPLGIRFLGIGGSPKWTFEETPRMPKSRYAIMSRY
FT                   MPKVGTHGLDMMYRTCTIQVNLDFSSEEDMRRKMQVSMKLQSLATALFASSPFTDGKPN
FT                   GLLSWRGEIWRDTDNRRAGLLPASFRPDFGFADYVEWALDVPMYFVVRDGHYHDCTHVT
FT                   FRQFMNGALKGEIAEWQPNMGDWTNHLSTLFPDVRLKRFLEMRGADGGPWRRICALPAF
FT                   WVGLLYDDQALADAETLTRDWSYDEVQALRDAVPAEGLAAKFRTTSLFDIAREVLAISR
FT                   AGLKRRNRLNGDGIDESQFLEPLGEVLAKKATLAEDLLALYDGRWNRSVDPVFTEYQY"
FT   gene            complement(431334..432071)
FT                   /locus_tag="NGR_c03860"
FT   CDS_pept        complement(431334..432071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03860"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03860"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24182"
FT                   /db_xref="GOA:C3MGR7"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGR7"
FT                   /protein_id="ACP24182.1"
FT                   /translation="MRANFRMQRLFVESPLHAGARHEATKDQFNYLINVLRFGEGSSIL
FT                   VFNGRDGEWRAELSLPSRKQLVLTAVEQTRPQPAPSDLVYLFAPLKTGRLDYLVQKAVE
FT                   MGAGVLQPVMTQHVQGKLGNLDRLRANVTEAAEQCGVLGIPSVETPRKLEELLANWPRE
FT                   RRIIFCDEGNESQNPLPILGGISERRLALLIGPEGGFSEAERVLLHSLDFVTAVPLGPR
FT                   ILRADTAAVAALALIQATLGDWR"
FT   gene            complement(432082..433590)
FT                   /locus_tag="NGR_c03870"
FT   CDS_pept        complement(432082..433590)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03870"
FT                   /product="putative phosphate transport permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03870"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24183"
FT                   /db_xref="GOA:C3MGR8"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGR8"
FT                   /protein_id="ACP24183.1"
FT                   /translation="MSKPRLRLEKLTIDKDLDKVSRAEEASQHVMRGLAAPGLGLLFLI
FT                   LSMAFAASYFTGASGMAIVVAGAAIAAYMAMNIGANDVTNNVGAAVGAKAMTMATALGI
FT                   AAVFEIAGAVIAGRKVTLTIEAGIVDGAQLVSLDVLVWVMMAALLSSAVWINIATYARA
FT                   PVSTTHSIVGGIIGAGMAAEGFASVKWWAIAGITASWSVSPLLGGAIAALFLAFLKEFV
FT                   IYRNDKIAAARYWMPIVLGVTAGSFTAYVAVSALVHLQVISLGTGLLIGTLAGIACYGL
FT                   CKPWIHRQSAGLENRNQSLRKLFRLPLIFSAALLSFAHGANDVSNAIGPLSAIVSAVNG
FT                   TISTARSEAPFWVLLIGALGISMGLLLYGPILIRVVGEEITRLNPMRAFCVALATAVTV
FT                   LLASALGLPISSTHTAVGAVFGVGFFREWYIRHSRRRLEYIRRRTGQTGFMGEAIETNF
FT                   AEVRRRRLVRRSYFLTIVAAWVITLPASALLSALVYRLLAGLFL"
FT   gene            complement(433802..434308)
FT                   /locus_tag="NGR_c03880"
FT   CDS_pept        complement(433802..434308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03880"
FT                   /product="putative NTP pyrophosphohydrolase protein,
FT                   MuT/nudix family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03880"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24184"
FT                   /db_xref="GOA:C3MGR9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGR9"
FT                   /protein_id="ACP24184.1"
FT                   /translation="MNFLHRLASDVHLMMRRPARMQYAALCYRIRKKTVSPEILLLTSR
FT                   DTGRWVIPKGWPMQGKWAHEVAEREAYEEAGVKGKAQKAAIGSYVYQKRMDHGLKIPCK
FT                   VQVHALEVDNLCKNFPEKGERKLEWVDYAEAARRVAEPSLKELILGFGKRMAAAQPPEP
FT                   AASEG"
FT   gene            complement(434562..435353)
FT                   /locus_tag="NGR_c03890"
FT   CDS_pept        complement(434562..435353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03890"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03890"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24185"
FT                   /db_xref="GOA:C3MGS0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGS0"
FT                   /protein_id="ACP24185.1"
FT                   /translation="MTEDQGDLYARISHSRTADEVVQQIELLILEGVLRDGDRLPGERD
FT                   LSKRLDVSRPILREALKELETRGLLESRHGGGTFVADVVGQIFSKPLIELIGRHHKATQ
FT                   DYLEYRRELEGLTAELAATRATDFDRDLLTRVIERMREAHRSGNFDDELEADVELHNAI
FT                   GESAHNIILLHTLRACYRLLTQGIFFHRSSVFGAPGARDRLLAQHEAIYAAIMARDPTT
FT                   AKAAAQSHIDFVAAAARDAERSGEWARIARLRLKQRDRAGS"
FT   gene            435564..436838
FT                   /locus_tag="NGR_c03900"
FT   CDS_pept        435564..436838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03900"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24186"
FT                   /db_xref="GOA:C3MGS1"
FT                   /db_xref="InterPro:IPR021830"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGS1"
FT                   /protein_id="ACP24186.1"
FT                   /translation="MAKASFGFPAAPLRAQVLGEIHSRPYALVTTPRVIFQLAFITEGG
FT                   SIVDHAVLSELSRSRGIAPPSRDANHHAMAWGQGTLRWERHTEFSTYFWDAPAPEQFGG
FT                   EVPIHPFGDGFSPPGLLISGIRLEIRPDTPEAREAIKAFDPTSLCYSETKNGQAVLLTD
FT                   FRQNGDGLTQILILDRGMTEAGTGALVQRLLDIETYRTLAMLGLPLAQSLSPEIRRTED
FT                   GLTGVTQRMKENVREEADEMLAEITRLAAELEAGAALSLYRFGASRAYYGIVQERIRTL
FT                   SETPVPGYETIGTFLERRLAPALRTCQSVEERQANLSRKLSRATALLRSWIDVELERQN
FT                   SALLNSMDRRAKLQLRLQQTVEGLSVAAISYYVIGLFGYLAKAVSHELPVDPGVLTGLA
FT                   VPFAVVGVWLVVRRIRRHHEESAHK"
FT   gene            complement(436862..437758)
FT                   /locus_tag="NGR_c03910"
FT   CDS_pept        complement(436862..437758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03910"
FT                   /product="putative transcriptional regulator protein, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03910"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24187"
FT                   /db_xref="GOA:C3MGS2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGS2"
FT                   /protein_id="ACP24187.1"
FT                   /translation="MTNLGDLEVFARVVSTGSMSAAGRALGLSAAVISKRVKRLEERLG
FT                   TRLLQRTTRQVSLTEAGQGFYDRVLGVLAGIEEAEAYAAGRSSQAQGTLRITAPTSFGR
FT                   MHIAPHLTGFMKDHPDLKLHIVLSDEFSDIVADGFDLAVRIGELTDSSLVARKLAPVRR
FT                   LLCASPDYISRHGAPKEIGDLAEHICLPAHNNESWKLEGPGGSLAYRPDGPLVTNSSEI
FT                   IRAAVIAGAGIALRSTWDVSAELRDGHLVQVLPEWEGSQRLTLSAVYPSRQFLPAKVRL
FT                   FVDYLSALYGPVPYWEQ"
FT   gene            438119..439558
FT                   /gene="glcD2"
FT                   /locus_tag="NGR_c03920"
FT   CDS_pept        438119..439558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcD2"
FT                   /locus_tag="NGR_c03920"
FT                   /product="glycolate oxidase, subunit GlcD"
FT                   /EC_number="1.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03920"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24188"
FT                   /db_xref="GOA:C3MGS3"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGS3"
FT                   /protein_id="ACP24188.1"
FT                   /translation="MPETIGFLKPRQAVLDRRPEIIADLADLLPEGCLISDERGLKPFE
FT                   TDAFLAYRRLPLAVVLPETTEQVSAVLKYCSRYGIPVVPRGAGTSLSGGAIPQEDAIVI
FT                   GLSKMSRILDVDLFNRTATVQAGVTNLNISDAVSADGFFYAPDPSSQLACTIGGNIGMN
FT                   SGGAHCLKYGVTTNNLLGVKMVLFDGTVIELGGKALDSSGYDLLGLVCGSEGQLGIVTE
FT                   ATVRLIAKPEGARPVLFGFASSVAAGSCVADIIGSGIIPVAIEFMDKPAIEICEAFAHA
FT                   GYPLDVEALLIVEVEGSEAEMDTMLESIIAIARRHGVMTIKESQSALEAALIWKGRKSA
FT                   FGATGRVADYICMDGTVPLSQLSHVLRRTGEIVASYGLRVANVFHAGDGNMHPLILYNI
FT                   NDPEDAARAEAAGNDILKLCVDAGGCLTGEHGVGIEKRDLMRHQYNKADLDQQMAVRAA
FT                   FDPQWLLNPSKVFPLEGRPAA"
FT   gene            439555..440766
FT                   /gene="glcE2"
FT                   /locus_tag="NGR_c03930"
FT   CDS_pept        439555..440766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcE2"
FT                   /locus_tag="NGR_c03930"
FT                   /product="glycolate oxidase, subunit GlcE"
FT                   /EC_number="1.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03930"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24189"
FT                   /db_xref="GOA:C3MGS4"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGS4"
FT                   /protein_id="ACP24189.1"
FT                   /translation="MIVHFEPASEEGIASVVRSAAAERVTLAIVGGGTRSGLGNPVRAD
FT                   RTLSTRRLAGIVAYHPAEMTMSALAGTPLAEVEAALAANGQMLSFEPMDHRPIFGTTGE
FT                   PTIGGVFAANVSGPRRYVAGAARDNLLGVRFVNGRGELIKAGGRVMKNVTGLDLVKLMA
FT                   GSYGTLGILTEVTFKVLPVPPAAATVVVSGLNDAEAAAVMAEAMAQPVEVSGAAHLPES
FT                   VRGRFIDGALPEGAATVLRLEGLAASVEMRAEKLVAALSRFGSRSQLDAGQAKALWAEI
FT                   RNVKPYADGTARPLWRVSVAPSAGHQLVAALRLQTGVDAFYDWQGGLVWLRMEAEAEAE
FT                   LVRRYVGALGGGHATLVRADGEARARAPAFEPQAPAVAQLSERVRATLDPARIFNPGRL
FT                   AAVA"
FT   gene            440918..441298
FT                   /locus_tag="NGR_c03940"
FT   CDS_pept        440918..441298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03940"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03940"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24190"
FT                   /db_xref="GOA:C3MGS5"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGS5"
FT                   /protein_id="ACP24190.1"
FT                   /translation="MPDPGPQTPLSRDTDRWLEPGKVNIQIIYLLYLVGFAIGVTVLVG
FT                   IVLAYLNRDKAEPWARTHYTWAIRTFWIALLFAVVSALLSVLLIGVLGFIATAVWIVVR
FT                   CVIGLQKAAREEPITDPESWLV"
FT   gene            441360..442655
FT                   /locus_tag="NGR_c03950"
FT   CDS_pept        441360..442655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03950"
FT                   /product="glycolate oxidase, iron-sulphur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03950"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24191"
FT                   /db_xref="GOA:C3MGS6"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGS6"
FT                   /protein_id="ACP24191.1"
FT                   /translation="MQTNFSREQLADPHVAESEKILRKCVHCGFCTATCPTYVLLGDEL
FT                   DSPRGRIYLIKDMLENGRAADAETVTHIDRCLSCLSCMTTCPSGVDYMHLVDHARVHIE
FT                   KTYKRPLKDRFARSVIAATLPYPSRFRLALRAARLARPLAGLLKRVAWLRTFGVMLDLA
FT                   PRAMPTASDGARAAVYAAKGTPRGRVALLTGCAQPVLRPEINEATVRLLTGQGVEVVVS
FT                   AGEGCCGALVHHMGREEQALDAARRNVDVWLKAADEDGLDAIVITASGCGTTIKDYGHM
FT                   LRLDPAYAEKAAKVSALAKDITEYLAGLDLPEQGARGMTVAYHSACSMQHGQKITLAPK
FT                   QLLKRAGFAVREPAEGHLCCGSAGTYNILQPEISAKLKARKVRNIEATKPNVIATGNIG
FT                   CITQIAGGTNIPILHTVELLDWAYGGPKPAGL"
FT   gene            complement(442717..443412)
FT                   /locus_tag="NGR_c03960"
FT   CDS_pept        complement(442717..443412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03960"
FT                   /product="putative exported ErfK/YbiS/YhnG protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03960"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24192"
FT                   /db_xref="GOA:C3MGS7"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGS7"
FT                   /protein_id="ACP24192.1"
FT                   /translation="MRLHATRLAALTVAAAAFLAAANASAFTPADIVGAKVKRSDVVLA
FT                   AQPKKPPQRFWRTKVRFRTDEAPGTVIVDTNNKYLYYIDGPNRATRYGIGVGREGFGWS
FT                   GVVKVGRKAEWPAWTPPAEMRQREKEKGRILPITQEGGIDNPLGARALYLYKGGRDTIF
FT                   RIHGTNQPWTIGQNMSSGCIRMMNEDVEHLYERAPIGTKVIVIGPGNKQGDVSYDDRGV
FT                   DIFRQIFGG"
FT   gene            complement(443721..444470)
FT                   /locus_tag="NGR_c03970"
FT   CDS_pept        complement(443721..444470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03970"
FT                   /product="putative exported ErfK/YbiS/YhnG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03970"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24193"
FT                   /db_xref="GOA:C3MGS8"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGS8"
FT                   /protein_id="ACP24193.1"
FT                   /translation="MMKKFLLLATCLVCTLPAGAGASDRYRNRPPVIVSPDLTAPWVMQ
FT                   LTGEGVRPAVYRPQAPAATRKQVERRPTKRRLETAAVQPAAAHRAQKPLKSQFDPQFLP
FT                   QMVAYDTGEKPGTIVIDTNNRFLYLVTGDGQARRYGVGVGKPGFEWAGAHKITRKSEWP
FT                   SWTPPGEMIAREAAKGHYLPDRMDGGPANPLGARAMYLGSTLYRIHGTNAPWTIGYGVS
FT                   SGCIRMRNEDVVDLYERVKIGTKVIVI"
FT   gene            444651..445328
FT                   /locus_tag="NGR_c03980"
FT   CDS_pept        444651..445328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03980"
FT                   /product="putative DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03980"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24194"
FT                   /db_xref="GOA:C3MGS9"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGS9"
FT                   /protein_id="ACP24194.1"
FT                   /translation="MVNGTKEKRDERAAMSARGLITGEDGRQRCAWHGNLEDYRRYHDE
FT                   EWGRPVTDDRRLFEKICLEGFQSGLSWLTILRKRESFRSAFSGFDFDAVAEFGEADIER
FT                   CLADPGIVRHRGKIVSTINNARRAKELRSEFGSLAAYFWAHEPDGSERPEVVDYETLIA
FT                   NPTTPASVRISKDLKKRGWTFVGPTTVYAFMQAMGLVNDHLEGCFCREGIEEMRRQFAR
FT                   PTT"
FT   gene            complement(445383..445754)
FT                   /locus_tag="NGR_c03990"
FT   CDS_pept        complement(445383..445754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c03990"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03990"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24195"
FT                   /db_xref="InterPro:IPR005183"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGT0"
FT                   /protein_id="ACP24195.1"
FT                   /translation="MSLKRILTALMIAASIGSPALSQESGHQGMKHDATAAEPAPSSRA
FT                   FAEANAKMHKDMDIDFTGNADVDFVRGMIAHHQGAIDMAKVELEYGKDEAIRKLAETII
FT                   KVQEGEIKMMKEWLAGHGG"
FT   gene            complement(446262..446690)
FT                   /locus_tag="NGR_c04000"
FT   CDS_pept        complement(446262..446690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04000"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04000"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24196"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGT1"
FT                   /protein_id="ACP24196.1"
FT                   /translation="MLTVMTPGAAAIRPLNPETHGAWTRALAKAGYVIDRWHCDVDSGA
FT                   FVVGLRTLSLLGLRQNPCGIIDLVRAYDQEDRATILSILEQATATSSSFCFSAMVRRPS
FT                   GSAYQLCCIGNSTLGAHGAGGSLQGVFAVPRSRSALPA"
FT   gene            446964..448487
FT                   /locus_tag="NGR_c04010"
FT   CDS_pept        446964..448487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04010"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04010"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24197"
FT                   /db_xref="GOA:C3MGT2"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGT2"
FT                   /protein_id="ACP24197.1"
FT                   /translation="MPSMNDKPKKPQKLKARLPRGFVDRSAADIRAVDEMIAKIREVYE
FT                   RYGFDPVETPLFEYTDALGKFLPDSDRPNEGVFSLTDDDEQWMSLRYDLTAPLARHVAE
FT                   NFNEIQLPHRTYRAGYVFRNEKPGPGRFRQFMQFDADTVGAAGVQADAEMCMMMADTME
FT                   ALGIARGDYVIRVNNRKVLDGVLEAIGLGGGDQANARLTVLRAIDKLDKFGPEGVRLLL
FT                   GEGRKDESGDFTKGAGLNEEQIRKILFFVGISDYAKSAGELAELVAGTGKGTEGVEELN
FT                   TIRSLVLSAGYEADRIKIDPSVVRGLEYYTGPVFEAELQFSVTNEKGEKVVFGSVGGGG
FT                   RYDGLVSRFMGQPVPATGFSIGVSRLMTALKNLGKLGVEEVVAPVVVCVMDRDIDSMGR
FT                   YQRFVQQLRHAGIRAEMYQGNKKNFGDQLKYADRRGSPIAIIQGGDERASGIVQIKDLI
FT                   EGKRLSGEIEDNVAWREARVAQVSVPEGDLVAKVREILAEQAEDRKRAG"
FT   gene            448487..449626
FT                   /locus_tag="NGR_c04020"
FT   CDS_pept        448487..449626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04020"
FT                   /product="ATP phosphoribosyltransferase regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04020"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24198"
FT                   /db_xref="GOA:C3MGT3"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MGT3"
FT                   /protein_id="ACP24198.1"
FT                   /translation="MPLINLPAFAGDLLADFERLKTLRVDTPVIQPAEPFLDMAGEDLR
FT                   RRIFMTQSETGDSLCLRPEFTIPVCLRHIETATGTPQRYAYLGEVFRQRREGSSEFYQA
FT                   GIEDLGDTDTAGADARAIGDAMRVLSNRLANRRLKVTLGDQSVFEAVIAACGLPGGWQK
FT                   RLIHAFGDPKQLQKLLGELADPKSPGVFGHEVERLAILGILDDEERLVAHLAETMEATG
FT                   YSTNASRSPRDIARRLKEKMELATTRLDRAALAVMREFLAFDLPLSEAPAALHAFAKKS
FT                   RLKIDDALSLFDARVAAIAKVGAESDLIRYRAAFGRPLDYYTGLVFEIEAEGAPAVLAG
FT                   GGRFDRLLTLLGAREHIPAVGFSLWLDRIERAIAAAGGA"
FT   gene            449627..450322
FT                   /gene="hisG"
FT                   /locus_tag="NGR_c04030"
FT   CDS_pept        449627..450322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="NGR_c04030"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04030"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24199"
FT                   /db_xref="GOA:C3MGT4"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MGT4"
FT                   /protein_id="ACP24199.1"
FT                   /translation="MTITIALPSKGRMKDDASAIFERAGMKIVAVGNDRSYRGRVEGWD
FT                   DVEVAFLSASEISREVGSGAVDFGVTGEDLVREGIADVDARVEFAARLGFGHADVVVAV
FT                   PEVWYDVDTMADLGDVAADFRARHGRRLAIATKYWRLTQQFFSGSHGIQLYRIVESLGA
FT                   TEGAPASGSADIIVDITSTGSTLKANHLKILSDGVILRSEACLVRARKPAHDGYPMIDR
FT                   IISSVRSVL"
FT   gene            450434..451141
FT                   /locus_tag="NGR_c04040"
FT   CDS_pept        450434..451141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04040"
FT                   /product="putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04040"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24200"
FT                   /db_xref="GOA:C3MGT5"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGT5"
FT                   /protein_id="ACP24200.1"
FT                   /translation="MADLSSFPITNRWPAKNSDIIQLYSLPTPNGVKISIALEELGLPY
FT                   EAHRISFDTNEQKSPEFVSLNPNGRIPAIIDPNGPDGKPIGLFESGAILIYLAEKTGKL
FT                   IPADAARRYETLCWVMFQMGGVGPMLGQFGHFFKFAADKVANNSYPVERYRDEAKRLLG
FT                   VLEARLEGRQWLMGDAYTIADIATYPWVEGARKFYGGAEVLDYKSFPNVMAWVERGLAR
FT                   PAAQRGMEIPRKE"
FT   gene            451287..452504
FT                   /locus_tag="NGR_c04050"
FT   CDS_pept        451287..452504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04050"
FT                   /product="putative ferredoxin reductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04050"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24201"
FT                   /db_xref="GOA:C3MGT6"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGT6"
FT                   /protein_id="ACP24201.1"
FT                   /translation="MSGRLVVIGGGQAAFALVAKLRALQDTRPITVIAAESSLPYQRPP
FT                   LSKKYLLREMTLDRLLYRPEAWYAEHGIDIRLSTSVTRVDRRASEVTLSDGSRLAYETL
FT                   AFATGATPRRLPASIGGDLAGVYVVRDFRDADRLAEEMKPGRRALVIGGGYIGLEAAAV
FT                   ARTCGLEVTVIEMADRILQRVASAATSAIVREIHRSHGVDIRERMGLHRLIGDNGPVTA
FT                   AELSDGSVIPVDVVIVGIGVGANDALAHDAGLETANGILVDGHGRTSDPAIFAIGDCAV
FT                   LPWQGMRIRLESVQNAVDQAEAVAAILAGGTAPYDPKPWFWSDQYDVKLQIAGFGLGHD
FT                   ETLVRPGQREGSVSVWYFRQGKLIAVDAINDAKAYVTGKKLLEAGVTPDPALLADPQVD
FT                   LKSLLA"
FT   gene            452726..455512
FT                   /locus_tag="NGR_c04060"
FT   CDS_pept        452726..455512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04060"
FT                   /product="putative diguanylate cyclase
FT                   (GGDEF)/phosphodiesterase (EAL) with PAS domain precursor"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04060"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24202"
FT                   /db_xref="GOA:C3MGT7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGT7"
FT                   /protein_id="ACP24202.1"
FT                   /translation="MFKILSCLVVEHDLRLVALAAIICALSSYGAVTLLQRARLSRGGP
FT                   RAIWLGAAGIASGFGIWATHFIAMLAYDPGVVLGYHTSLTTLSLVVAILLTTTALAIAT
FT                   YAKGRPAWLLGGLVLGAGVGCMHFLGMAALELPGFIRWDRTLVVASVLAGVLFEMVAIF
FT                   AIKRDQSKAQLAATAAMTLGIVVLHFTAMGAVTMEVEFATGIQEGMIQPHFLAFVLAGT
FT                   AFFLLSAVLIAAGFARHAEILAVASEKEFSRFVGSVKDYAIYMLDVDGRVASWNAGAEA
FT                   NKGYTAEEIVGKNFACFYSPEDQAANLPARALRIALEAGQYETEGWRYRKDGTRFWAHV
FT                   VIDTIVGEDGGHAGFIKIAKDITKRKEDADRIAEVSKNLDIALENMTQGICLFDHADRL
FT                   LISNRRCLEIFELPESLAGFGLTFREVLDRMCARTYPDPAVAEAKSEAAYRKHRLEIAG
FT                   KGGGDFVEKLSNGRSILVKHRTLPDGGWVSTYEDITERLDSEEQISFLARHDSLTGLPN
FT                   RLQFNSHLDEELDAAVWFSRKVAVIGIDLDKFKEVNDLHGHAAGDFVLVTIAQRMKEHL
FT                   QEGEFVARFGGDEFAAVKRFEDLSEVHDFLRRIETCLQEEMRFGDFELKSGGSMGVAIY
FT                   PQDAETADTLINNADLAMYRAKAALNQTICFYEVSMDEAARGRRALANDLWEAVERSEL
FT                   ALHYQVQKSVTTGDVIGYEVLLRWNHPERGLVPPNEFIPLAEECGAILPIGEWVLRQAC
FT                   REAASWDAEYKIAVNLSPVQLANGDVVSLVHSILVETGLDAKRLELEITESTIIDDKER
FT                   ALLTLRAIKALGVTIAIDDFGTGYSSLETLRAFPFDKIKLDKSFMSEVEGSPQAKAIIR
FT                   AILALGHSLQVPVLAEGVETQKQLDILQAEGCDEAQGYLLGRPAPIGSVVGVRTEAA"
FT   gene            455611..455964
FT                   /locus_tag="NGR_c04070"
FT   CDS_pept        455611..455964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04070"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24203"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGT8"
FT                   /protein_id="ACP24203.1"
FT                   /translation="MRAADAALLDPCDKHRDEGERAFAKPNYATVVYLASERPRRCEGR
FT                   YGLGLVIMRDELGRGSPNRTRFPRERMILKKLPQKYPTAKRAAREPPFDPDGSPVLRLS
FT                   PCHIMSVPPVQRA"
FT   gene            complement(456136..457773)
FT                   /gene="groEL1"
FT                   /locus_tag="NGR_c04080"
FT   CDS_pept        complement(456136..457773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="groEL1"
FT                   /locus_tag="NGR_c04080"
FT                   /product="60 kDa chaperonin 2"
FT                   /note="protein Cpn60 2; GroEL protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04080"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24204"
FT                   /db_xref="GOA:C3MGT9"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGT9"
FT                   /protein_id="ACP24204.1"
FT                   /translation="MAAKEVKFGRTAREKMLRGVDILADAVKVTLGPKGRNVVIDKSFG
FT                   APRITKDGVSVAKEIELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVREGA
FT                   KAVAAGMNPMDLKRGIDLAVAEVVKDLLAKAKKINTSDEVAQVGTISANGEKQIGLDIA
FT                   EAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDAFILL
FT                   HEKKLSNLQAMLPVLEAVVQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAVKAPGF
FT                   GDRRKAMLEDIAILTGGTVISEDLGIKLENVTLDMLGRAKKVSISKENTTIVDGAGQKA
FT                   DIEGRVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEIEVKEKKDRIDDA
FT                   LNATRAAVQEGIVPGGGVALLRSSVKITAKGENDDQDAGVNIVRRALQAPARQIAENAG
FT                   DEASIVVGKILEKNTDDFGYNAQTGEYGDMIAMGIIDPVKVVRTALQDAASVASLLITT
FT                   EAMIAELPKKDAPAMPGGMGGMGGMDMM"
FT   gene            complement(457852..458148)
FT                   /locus_tag="NGR_c04090"
FT   CDS_pept        complement(457852..458148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04090"
FT                   /product="10 kDa chaperonin Cpn10"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04090"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24205"
FT                   /db_xref="GOA:C3MGU0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGU0"
FT                   /protein_id="ACP24205.1"
FT                   /translation="MASTNFRPLHDRVVVRRVESEEKTKGGIIIPDTAKEKPQEGEIVA
FT                   VGSGARDESGKVVPLDVKAGDRVLFGKWSGTEVKINGEDLLIMKEADIMGIIG"
FT   gene            458414..459241
FT                   /locus_tag="NGR_c04100"
FT   CDS_pept        458414..459241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04100"
FT                   /product="Rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04100"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24206"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR018634"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGU1"
FT                   /protein_id="ACP24206.1"
FT                   /translation="MASFNSISPEKLSRLVGTPKGPVLIDVRDEDDFTADPHLVPSSFH
FT                   RPHADAPTWADEYKGQWVVVLCKHGGKLSEGVAAWLRLAGAAAEILEGGLEGWREADLP
FT                   LVPVASLPKAAASGGSVWVTRARPKIDRIACPWLIRRFVDPHARFLYVTPAEVEAVGER
FT                   FGATPFDIEGVFWSHRGDDCTFDTMVKEFRLSFPALEHVARIVRGADTDRHDLEPQAAG
FT                   LLAVSLGLSRMYTDDLEQLEAGMTLYDALYRWARDATQEKHDWVSHGGKGKRT"
FT   gene            459238..460596
FT                   /locus_tag="NGR_c04110"
FT   CDS_pept        459238..460596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04110"
FT                   /product="Chromate transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04110"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24207"
FT                   /db_xref="GOA:C3MGU2"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGU2"
FT                   /protein_id="ACP24207.1"
FT                   /translation="MNEQSSAGLAPAHPSFAEATKVWAKIGLLSFGGPAGQIALMHREL
FT                   VEERRWISESRFLHALNYCMLLPGPEAQQLATYIGWLLHGTRGGVVAGTLFVVPGFFVI
FT                   LALSSAYALFQETNWLASLFFGLKAAVLAIVIEALIRLSRRALKTGFDRVLAIVAFLAL
FT                   FAFGLPFPLVVVAAGVAGYVAARHAPARRDAAHAAKAPDLPSVIGADYPDGKPTWGRAA
FT                   AVVAVWGALWLAPFALIFATVGGKNVYTDVGVFFSQMAVVTFGGAYAVLAYVAQQAVET
FT                   YHWLQPGEMVDGLALAETTPGPLVLVLAFVGFMGAYRAPIGVDPLTSGMLGATLATWVT
FT                   FVPCFMWIFLGAPYVERLRANVALSGALSAISAAVAGVILNLAVWFGLHVLFGRVERLE
FT                   AGPLSLPYPDPTTLHPAALFLTILAAASLLWWKRGVFQTLAICAAAGWLLMLV"
FT   gene            460708..461556
FT                   /locus_tag="NGR_c04120"
FT   CDS_pept        460708..461556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04120"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04120"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24208"
FT                   /db_xref="GOA:C3MGU3"
FT                   /db_xref="InterPro:IPR006356"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGU3"
FT                   /protein_id="ACP24208.1"
FT                   /translation="MAVRINSYREIASRYDVVLCDVWGVLHNGVQAFASACEALAEARA
FT                   QGVTVVLITNSPRPHPSVKVQIRGLGVPDEAYDRIVTSGDVTRALIAAAEKRIYFIGAD
FT                   RDLPLLEGLGTEIVSAEEAEAIVCAGFYDDETETPEHYRATLTGLAKRKIPFICANPDL
FT                   VVERGHRLIPCAGAIAKLYEELGGEARIAGKPYKAIYRAALGEAKAVRGAFDLARVVAV
FT                   GDGMPTDVKGAQDAGFDLLYISAGIHAQEYMHESRTDEAKLAAFLKKEGATPKWWMPRL
FT                   A"
FT   gene            461570..462640
FT                   /gene="ribF"
FT                   /locus_tag="NGR_c04130"
FT   CDS_pept        461570..462640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="NGR_c04130"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /EC_number="2.7.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04130"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24209"
FT                   /db_xref="GOA:C3MGU4"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGU4"
FT                   /protein_id="ACP24209.1"
FT                   /translation="MTVFHRNETRDPLPERLHGGVIAIGNFDGVHRGHQSVLNRALDEA
FT                   KGRGVPALVLTFEPHPRTVFRPDQPVFRLTPAPLKARILEGMGFGAVIEYPFDRTFSEL
FT                   SASRFHPPHPARMAARLTCRHRFRFPFWQGAGRRSGLPDGGRLEGRLRRDAGGRLPRRE
FT                   RLRHFFELHPLLAGRRRCLACGRHARLSLHGRSGGDRRQEARAHPRLSDREHAPTAGSR
FT                   TPKRHLCGALPPSGRFSLRRRRKLRPPSDRRQRWRSAAGDLRLRLLRRSLRRGLRRLLL
FT                   WASARRAEIRRAGAFDGAYERGREGGACPSCRRSAFERDRPPDQFRLRWAREAVCWRKE
FT                   SRHAALADLFKRPKTP"
FT   gene            462822..465743
FT                   /gene="ileS"
FT                   /locus_tag="NGR_c04140"
FT   CDS_pept        462822..465743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="NGR_c04140"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04140"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24210"
FT                   /db_xref="GOA:C3MGU5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGU5"
FT                   /protein_id="ACP24210.1"
FT                   /translation="MQKTMTETAEKIDYSSTLYLPQTEFPMRAGLPQKEPETVARWQKM
FT                   ELYKKLRASAAGREKFVLHDGPPYANGNIHIGHALNKILKDVINRSFQMRGFDANYVPG
FT                   WDCHGLPIEWKIEEKYREKGRNKDDVPVNEFRQECRDFASGWIEVQTEEFKRLGIEGDF
FT                   DKPYTTMNFHAEARIAGELMKIAKAGQLYRGSKPVMWSVVERTALAEAEIEYADVESDM
FT                   IWVKFPVAEGPDALAGAFVVIWTTTPWTIPGNRAVAYSSRYAYGLYEVATAENDYGPQP
FT                   GEKLIFAKRLADESAAKAKVTFNFVRDLEPEELGTVTCAHPLHGLGGGYAFQVPLLDGE
FT                   HVTDDAGTGFVHTAPSHGREDFEAWMENVRLLEDRGISSAIPFPVDDAGYYTADAPGFG
FT                   PEAEGGAGRVIDDKGKKGDANDRVIKALIARHALFARGRMKHSYPHSWRSKKPVIFRNT
FT                   PQWFVYMDKDFGDGTTLRSRALNAIDDTRFVPGAGQNRLRAMIEQRPDWVLSRQRAWGV
FT                   PIAIFADDDGQILVDEKVNARILEAFEEEGADAWFAEGAKERFLGNDHDHARWHQVMDI
FT                   LDVWFDSGSTHTFTLEDRPDLKWPADVYLEGSDQHRGWFHSSLLESCATRGRAPYDAVV
FT                   THGFTMDEKGEKMSKSKGNTVTPQEVMKDAGADILRLWVMTTDYWEDQRLGKTIIQTNI
FT                   DAYRKLRNTIRWMLGTLAHDKGETIALADMPELEQLMLHRLAELDRLVREGYDAFDFKR
FT                   IARALIDFSNVELSAFYFDIRKDALYCDAPSSLRRRAALQVIRTLFDCLVTWLAPMLPF
FT                   TAEEAWLSRNPEAVSVHLEQFPAVPAEWRNEVLAEKWRKIREVRKVVTGALEIERKDKR
FT                   IGSSLEAAPIVHVADPDLRAALDGQDFAEICITSAIEIDGAEGPAGAFTLPDVAKVGVV
FT                   PKLAEGRKCARSWRITTDIGSDPFYPDVSARDAAALRELGFKP"
FT   gene            465869..466492
FT                   /locus_tag="NGR_c04150"
FT   CDS_pept        465869..466492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04150"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24211"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGU6"
FT                   /protein_id="ACP24211.1"
FT                   /translation="MEMTRELRVFAGIAAVVAGSLVLSGCIGGPTYGTDKSAGEQLVDD
FT                   LGSAISLAPPKKDPVKYQPRAGLVLPPQQGEQAALIQPQQSLANREANPAWVESPEEVR
FT                   NRLREEADANKNNPNYVSPLAKASANGRRLSAKEQQAAYREARKIEMGAYSDKRRFLSD
FT                   PPLEYRRLPEGAETDLGEAEKDKERRRKKAAQVANSGSKWYWPF"
FT   gene            466496..466975
FT                   /locus_tag="NGR_c04160"
FT   CDS_pept        466496..466975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04160"
FT                   /product="putative acetyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04160"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24212"
FT                   /db_xref="GOA:C3MGU7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGU7"
FT                   /protein_id="ACP24212.1"
FT                   /translation="MAIGIRDAVPDDAATILRFITELATYEKAEHEVEATVELLTASLF
FT                   GPDRVSRAVICEVDGAPAGFAIWFYNYSTWQARKGLYLEDLYVTPEHRGSGAGKMLLKH
FT                   LARIAIAEGCGRFEWSVLDWNEPAIRVYEAIGAEPLSEWTRYRLVGKELEALAAS"
FT   gene            complement(466986..467438)
FT                   /locus_tag="NGR_c04170"
FT   CDS_pept        complement(466986..467438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04170"
FT                   /product="putative cytidine and deoxycytidylate deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04170"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24213"
FT                   /db_xref="GOA:C3MGU8"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGU8"
FT                   /protein_id="ACP24213.1"
FT                   /translation="MMAETTRYMDAALDEARKAAARGEVPIGAVVVLDGEVVAAAGNRT
FT                   RELRDITAHAEIEAIRQAAAAVGDERLSGADLYVTLEPCTMCAAAISFARIRRLYYGAE
FT                   DPKGGAVENGVRFYGSPTCHHVPDVYSGLAEREAADLLRAFFTARR"
FT   gene            467508..469331
FT                   /locus_tag="NGR_c04180"
FT   CDS_pept        467508..469331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04180"
FT                   /product="pseudouridylate synthase, subunit B protein"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04180"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24214"
FT                   /db_xref="GOA:C3MGU9"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGU9"
FT                   /protein_id="ACP24214.1"
FT                   /translation="MTFKDKSTGPGKGKGRKGNYSSGEKKANAARPGNAAPKADAGLDE
FT                   PQRISKILSRAGVASRRDIERMIMEGRVKLNGVVLETPVVNATLADQIEVDGHPIRGIE
FT                   RTRLWLYYKPAGLVTTNSDPEGRPTVFDNLPDELPRVLSVGRLDINTEGLLLLTNDGGL
FT                   ARALELPSTGWLRRYRVRAHGEIDQEALDRLKEGIAVDGVLYGAIEATLDRVQGSNVWI
FT                   TMGLREGKNREIKNVLGALGLDVNRLIRISYGPFQLGELPEGHVQEIRGRTLRDQLGPR
FT                   LIAESKANFDAPLYNDQPAAPEREAHNEVAPEWGKERSARREKPEDKRERALARLDTQR
FT                   DDSRSRDRRERPREKFEDRPARPPAKRSRTANVWMAPGARPVAEKKPKGAEEDTSPKPA
FT                   RRERPEGAPKTKRYGRTKDGAATKTSAKFDPDRKARPAKADARPDRAPRPPVKRADEDG
FT                   DWISASEPVRRKDEARDGGFERRRPFDSGERKSRDHGDRPPRREGSERPRGERPARAAG
FT                   DSRAFSEKPRTSRSKDDRPQGREGGDRPFGDRPRGKAPGGKPAGGKSFGQRSGGPRGGG
FT                   KPGGGKPGGGRPGGGKPGGRTGGGKPRGKGK"
FT   gene            469338..469895
FT                   /locus_tag="NGR_c04190"
FT   CDS_pept        469338..469895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04190"
FT                   /product="putative methylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04190"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24215"
FT                   /db_xref="GOA:C3MGV0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGV0"
FT                   /protein_id="ACP24215.1"
FT                   /translation="MRIVGGEFRGRALATPKSNDIRPTTDRTRESLFNILSHGYPGVLD
FT                   GGRVLDLFAGTGAVGLEALSRGCRQALFVEQGVEGRGLIRVNIEALGLQGRAKIFRRDA
FT                   VDLGPVGTMEPFHLVFADPPYGKGLGERALASAAAGGWLVPGALVVLEEQADVRPQLSA
FT                   AFEPLDDRAFGDTRMHFYRFLG"
FT   gene            469980..470864
FT                   /locus_tag="NGR_c04200"
FT   CDS_pept        469980..470864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04200"
FT                   /product="putative patatin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04200"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24216"
FT                   /db_xref="GOA:C3MGV1"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGV1"
FT                   /protein_id="ACP24216.1"
FT                   /translation="MEQHVADRRDRSDTKGEPMIAVAFGGGGARGLAHIHVIEALDEMG
FT                   IRPSAIAGSSIGAIMGAGMAAGMTGREIRDYTLATVGNRGEVLNRLWQLRPNSLSEAVS
FT                   SGFRFGQFNIERVLKAFLPGAIPARFSDLLIPLKVTATDYYGQSERICESGDLHKAIAA
FT                   SCALPAIFMPVKIEGRVMIDGGMYNPIPFDHLRELADIVIAVDVVGGPDGDGKTIPSRI
FT                   DSLFGASQLMMQSIIAMKMKAGAPDILLRPEVGRFRALDFLRARDVLAATASTKEQLKR
FT                   ALSERIDQWQAGR"
FT   gene            complement(470922..472778)
FT                   /gene="kefB"
FT                   /locus_tag="NGR_c04210"
FT   CDS_pept        complement(470922..472778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefB"
FT                   /locus_tag="NGR_c04210"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04210"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24217"
FT                   /db_xref="GOA:C3MGV2"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGV2"
FT                   /protein_id="ACP24217.1"
FT                   /translation="MQTTPILYTQALMLLGGAVVAAPLFKRLGLGTILGYLAAGIVIGP
FT                   VAQSITEGEEILHVSELGVVFLLFIIGLELKPSRLWQMRRDIFGLGTAQVLVTGLVLSF
FT                   LIEFFSLLEWRGSVIAGFGLALSSTAFAMQILDENNDTNTRYGQRAFSILLLQDLAIVP
FT                   LLALIPLMATRAPEATTTAFEDFAIAIAAIAALYAAGRYLLNPLFQVIARTGARDVMIA
FT                   AALLVVMGAATMMQLAGLSMAMGAFLAGVLLAESSYRHELEADIEPFRGILQALFFMAV
FT                   GLSLELHVIAENYLLILVAVPVLMAVKSLVLYGICRATGSHHNDAVRISLLLPQGGEFG
FT                   FVLFTAAAIAGVFTQGVGSLLVAIVTLSMALTPVAALLSKRLLREHEELEDEIEEDFEG
FT                   AGADVLMIGFSRFAQIAAQILLAGGRDVTIIDHSAARVRQAATFGFRIYFGDGTRLDVL
FT                   RAAGIEKAKIVAVCTQKKEITDRIISLVQAEYPNARIFARSYDRLHTLELRAMGVEYEL
FT                   RETFESGLLFGRKTIEALGVGGEEALAIMDDIRRRDEARLVLQEAEGITAGRHMLHSEP
FT                   VRPEPLVKPKRDVNHTVETEERILTQLPAANDGRADTLASAD"
FT   gene            472916..474277
FT                   /locus_tag="NGR_c04220"
FT   CDS_pept        472916..474277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04220"
FT                   /product="putative Zn-dependent protease, PmbA-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04220"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24218"
FT                   /db_xref="GOA:C3MGV3"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGV3"
FT                   /protein_id="ACP24218.1"
FT                   /translation="MKGLIMSETIDSAILEKRAAELVDRACQAGAEAADAVVVRGRSRS
FT                   VSVRLGKVEATEASESDDFSLRVFVGRRVASVSANPGFDLKVLAERAVAMAKASPEDPY
FT                   ASLADPDRLAKSYPDLDLFDMREVSSEALTEAALAAEAAALSVAGVTNSSGAGASAGMG
FT                   GLVLVTSHGFSGSYLATRFGRSVSAIAGEGTKMERDYDYDSRLYFDDLRSADDIGRVAG
FT                   ERAVARLNPRQVPTAKNVTVVFDPRMARGFVGHLAGAINGASVARKTSFLRDMMGKQIM
FT                   KAGIAVTDDPLIVRGSSSRPFDGEGVTGSKLSMVEDGVLKHWFLSTSAARELGLETNGR
FT                   GVRGGPTVNPASTNLALEPGTLSRDDLIRDVGTGFYVTELIGQGVNMVTGEYSRGASGF
FT                   WIENGELTFPVSEVTIASNLKHMFMALTPADDIDRKFGIAAPTLAVEGMTLAGT"
FT   gene            474342..475160
FT                   /locus_tag="NGR_c04230"
FT   CDS_pept        474342..475160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04230"
FT                   /product="inositol monophosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04230"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24219"
FT                   /db_xref="GOA:C3MGV4"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGV4"
FT                   /protein_id="ACP24219.1"
FT                   /translation="MSEAALQTASSRNEDLKLILAAAVAAGDTALGYFRKSVDVRWKNE
FT                   GRSPVSEADLAANDILKTRLLGARPDYGWLSEETDDDATRLARDTVFVVDPIDGTRAFI
FT                   SGKDLWCVSVAVVHQGRPTAGVLYAPALGEIFEATLDGEARKNGAAIAVRDPVPDERLQ
FT                   VAMAEDLVGKLAVPYRDRLARVPHVPSLAYRLAMIADGRIDGTIVKKNAHDWDLAAADL
FT                   ILARAGGALRGLDGMPLSYNRPIVSHGVLGAGSGLALPSLLAASRPFDAH"
FT   gene            475219..475455
FT                   /locus_tag="NGR_c04240"
FT   CDS_pept        475219..475455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04240"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24220"
FT                   /db_xref="InterPro:IPR025226"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGV5"
FT                   /protein_id="ACP24220.1"
FT                   /translation="MAQNTEKKQLLHLVFGGELTTLTDVQFRDLNDLDIVGIFPDYESA
FT                   HVAWKAKAQMTVDNAHMRYFIVHMHRLLDPEHD"
FT   gene            475489..476802
FT                   /gene="kdtA"
FT                   /locus_tag="NGR_c04250"
FT   CDS_pept        475489..476802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /locus_tag="NGR_c04250"
FT                   /product="3-deoxy-D-manno-octulosonic acid transferase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04250"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24221"
FT                   /db_xref="GOA:C3MGV6"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGV6"
FT                   /protein_id="ACP24221.1"
FT                   /translation="MSSLRARLALSSYRWLGTAIYPFVVPYLAVRAAKGKEDPARRRER
FT                   YGHASAPRPPGPLVWFHAASVGETVAVTPLIKEIRRRGIAVVLTTGTTTSARVAAERLG
FT                   TAVIHQYVPLDFKPAVSRFLEYWQPDLAIIAESEIWPMTIVELGRRHIPQVLVNGRLSD
FT                   RTFARWKKRPSLADALFENLALVIAQSDVDAERFRTLGALPVMVSGNLKVDTDAPPHDP
FT                   QALRDYSQQIGARKTWAAISTFEGEEEAAGVVHHALKQRNGLLTIVVPRHPERGDAVEA
FT                   ALAAKGLKVARRTRGDRLTPDVDIFLGDTIGEMGLYLRLTEIAFVGRSLFAEGGQNPLE
FT                   PAMLGCAVLSGGNVQNFRETYQMLAKNGSAKIVRDVEMLAKGVNYLLGNDDMRRSMIDA
FT                   GLETVQQMRGALTATMKGLEPYVNPLVVKARLEPRAES"
FT   gene            476822..477526
FT                   /locus_tag="NGR_c04260"
FT   CDS_pept        476822..477526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04260"
FT                   /product="putative phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04260"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24222"
FT                   /db_xref="GOA:C3MGV7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGV7"
FT                   /protein_id="ACP24222.1"
FT                   /translation="MAAGNGITGILFDKDGTLLDYAKSWVPVNYELARIAARGDERLAR
FT                   VLLQAGGMDPDTGHVAPDSLLAAGNTVEIATGMVEAGAPFTVEELTTLFDGLFAQSADY
FT                   AVPVTDLGAFFAALHAKGYRLGVASSDNERSIRETAKRFGFENYLHYVAGYDSGYGVKP
FT                   QPGMVLGFCAATGLAPAQVAVVGDNNHDMHMGRNAGVGMTIAVLTGTGSRQSLAEASDH
FT                   CLADITELEAVL"
FT   gene            477656..478696
FT                   /gene="lpxK"
FT                   /locus_tag="NGR_c04270"
FT   CDS_pept        477656..478696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxK"
FT                   /locus_tag="NGR_c04270"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04270"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24223"
FT                   /db_xref="GOA:C3MGV8"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MGV8"
FT                   /protein_id="ACP24223.1"
FT                   /translation="MVSEAPPFWWTKADWRAYALWPFAWAYGRVAAIRMDRARRAMPPV
FT                   PLICVGNFTVGGAGKTPTAIALAQAAKARGLKPGFLSRGYGGSLDVTTVVDPGHHRARD
FT                   VGDEPLLLAREALTVVCRRRVDGARRLAAEGADIIIMDDGFQSARLTFDFALLVIDSMR
FT                   GIGNGHLVPSGPVRAPIADQLRHATALLKIGHGPAADRLIRRAARAGKAIYVADTVRLD
FT                   DGSMSGVKVLAWAGIADPEKFYRTVRDAGAIVEETRSFPDHHHFSDDEIADLIDRAASQ
FT                   GYTLVTTAKDMVRLEPGHGRAAELAAKSRVIEIEVRFDDPLAPAKIIDATLAAARARKL
FT                   RANGKG"
FT   gene            complement(478721..478954)
FT                   /locus_tag="NGR_c04280"
FT   CDS_pept        complement(478721..478954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04280"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24224"
FT                   /db_xref="InterPro:IPR018661"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGV9"
FT                   /protein_id="ACP24224.1"
FT                   /translation="MMNRFDGNSSREAKIRYLDGDFQIVLAGSHVVCAMTGKAIPVDEL
FT                   RYWSVSRQEPYIDADASLEAERRAGALPRQQA"
FT   gene            complement(479082..480884)
FT                   /gene="mutL"
FT                   /locus_tag="NGR_c04290"
FT   CDS_pept        complement(479082..480884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="NGR_c04290"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04290"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24225"
FT                   /db_xref="GOA:C3MGW0"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR014790"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037198"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="InterPro:IPR042120"
FT                   /db_xref="InterPro:IPR042121"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MGW0"
FT                   /protein_id="ACP24225.1"
FT                   /translation="MAIKQLSETLINQIAAGEVIERPASAAKELIENALDAGATRIEVA
FT                   TAGGGKTLLRVTDNGNGMSPADLELAIRRHCTSKIDDTLTDIRTLGFRGEALPSIGSVA
FT                   RLSITTRTAGAREGAAISVIGGKTESVRPSPANVGTVVEVRDLFFATPARLKFMKTEKA
FT                   EAAAISEVVRRMAIAFPKVRFVVSGSDRSTLEFPATGDDRLARMAQVLGKDFRDNAIGI
FT                   DAEREEARLSGFAGVPTFNRGNSLQQYAFVNGRPVQDKLILSAIRAAYAETIPQGRYPV
FT                   AVLSIALDPALVDVNVHPAKSDVRFRDPGLIRGLIIGAIREALSRGGDRAATTGAQGMM
FT                   RSFRPEAYRAEPHRAQAPWTAATSPYRPMRFDEPARGFAEAPQAAFQEFAQPAARPAET
FT                   APNGTVEPAFPLGAARAQLHENYIVAQTEEGLVIVDQHAAHERLVFEAMRTALHSRPVP
FT                   AQALLIPEIVDLAEDDCDRLMAHAEEFLRLGLSIERFGPGAIAVRETPAMLGEMDASGL
FT                   VRQLADELAEWDTANGLAGRLDYLAATMACHGSVRSGRRMRPEEMNALLRQMEATPGSG
FT                   QCNHGRPTYIELKLADIERLFGRS"
FT   gene            481256..482980
FT                   /locus_tag="NGR_c04300"
FT   CDS_pept        481256..482980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04300"
FT                   /product="putative two-component sensor histidine kinase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04300"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24226"
FT                   /db_xref="GOA:C3MGW1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGW1"
FT                   /protein_id="ACP24226.1"
FT                   /translation="MNDVASGGADISRIVLESSCDALGLALLVCGRDDTILHASASMLQ
FT                   FFPVQPHLLKPGTRLRDFLGAVYDTGLRPGTLPESSRRRANREDWIAEQMGLHWRERYE
FT                   SVERAGRTRWICLRKRRLSSGMGILSVSDVSDQKKREEQLHTDLERVELTEQILDAQPN
FT                   PICVKDRNLNYIAANKAFCAIHDVAPEAILGRSAWDVVDAELAERFEQSDRHVLATGRP
FT                   HSEAEHIVRADGSDLWVVTRKYRVGVPGRHFVVTCMNDVTDIAAWYHGAEDGGGNSGLQ
FT                   IRDYSIFTPAQNFYDPFRALNVQQLVDAGSMIETLPARGLRVLLATADREMEDRIVARL
FT                   RGSGLDACAVRNREELDAFAATAGDCGVKLDILALDTALPARDAILAGWKTCPVLEVSS
FT                   QADATTLLGEIFKACTDRHQARSHFPPADWEVSFEGDATARTSASEVEVLVAEDNQINQ
FT                   FVFAQILDGLGVSYRIAANGREAVELWQELQPSLVLMDISMPVMNGFEAAAAIRDAESQ
FT                   TGRRTPIIAVTAQALDIDLKRCEASGMDDHIMKPISPDMIEALLRKHMRPATVRLTA"
FT   gene            483406..484746
FT                   /locus_tag="NGR_c04310"
FT   CDS_pept        483406..484746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04310"
FT                   /product="putative sensory box/GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04310"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24227"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGW2"
FT                   /protein_id="ACP24227.1"
FT                   /translation="MILAELASDRRGPDRLPFVDPLTGLGNAQQLRHKVCELAAERASD
FT                   PAPFTIGLANLDGFKPINDLFGPEAGDRILRQVAQRLTACVPEGATVIRTADDEFALVL
FT                   PLVFERKSAEKLGQMLKEILSAPFDLGDRTVRLSASFGFAVYPFAGAEFEDLLKSADTA
FT                   LYRSKRRGRGQITVYSQEIAQEMKRATQLEQALRNAIIAEEIDVHFQPIVDLRNDGVVG
FT                   FEALARWCDPEFGYVSPSVFVPLAEERGFIEALAEMLLRKAAQTALAWPKELFLSFNLS
FT                   SAQLMDPATSGRLLAIVHQVGLDPRRLELEITETAVMADADVAQKIVSELRAAGVRVSL
FT                   DDFGTGQSSLCRLRDFSFDKVKIDRAFVSRISADRASEHIVKAIVSMCEGLELEVVAEG
FT                   IEDISEVLKLKALGCGMGQGYFYGKPADAVATLRYLSDRHREPAAAR"
FT   gene            complement(484823..485614)
FT                   /locus_tag="NGR_c04320"
FT   CDS_pept        complement(484823..485614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04320"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24228"
FT                   /db_xref="GOA:C3MGW3"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGW3"
FT                   /protein_id="ACP24228.1"
FT                   /translation="MYRQVAAIWKRRQPPALDFDFFRNSFGCRTLLEYHRRGAIGSPEA
FT                   APCPTTSTKGKIDMTDKFISSVAAGALLVGVAVAPMSFAQETTTPPPAPAPETQTMEPA
FT                   APAPADQAQTPAPADKSTDMAAAGSYLTEQAEDQISANTYIGQSVYNANDESIGEINDL
FT                   IIKKEGGVAAAVVGVGGFLGIGEKNVAVPFESIEVTEQPDSDALKLTTTETAESLKGAP
FT                   EFKTKSQLMAERNAAQPVDTSTTSATGTTPAPAPAEPAPQQ"
FT   gene            complement(485910..487634)
FT                   /locus_tag="NGR_c04330"
FT   CDS_pept        complement(485910..487634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04330"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04330"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24229"
FT                   /db_xref="GOA:C3MGW4"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGW4"
FT                   /protein_id="ACP24229.1"
FT                   /translation="MSDKKKELRSRHWYGGTHKDGFIHRSWMKNQGFPDHVFDGRPIIG
FT                   ICNTWSELTPCNSHLRILAEGVKRGVWEAGGFPVEFPVSSLGETQMRPTAMLFRNLLAM
FT                   DVEEAIRAYGIDGVVLLGGCDKTTPGQLMGAASVDLPTIVVSSGPMLNGKWKGKDIGSG
FT                   TDVWKFSEAVRAGEMSLQEFMAAESGMSRSPGVCMTMGTATTMASVVEAMGLSLPTNAA
FT                   LPAVDARRMALAHMTGKRIVDMVHEDLRLSKVLTRKNFENGIIANAAVGGSTNAVVHLL
FT                   AIAGRAGVDLCLEDFDRVGGQVPCIVNCMPSGKYLIEDLAYAGGLPAVMNRIQHLMHAD
FT                   APTVFGVPISKYWEGAEVYNDDVIRPLDNPLRAAAGIRVLKGNLAPNGAVIKPSAASEH
FT                   LLAHEGPAYVFETIEDLKAKIDDPDLPVTEDTILVLKGCGPKGYPGMAEVGNMPIPRRL
FT                   VEKGVRDMVRISDARMSGTAFGTVVLHVSPEANAGGPLAIVKTGDRIRLDSMKGELNLL
FT                   ISEEEFANRMAAWQPPEQKWQRGYYKLYHDTVLQADKGADLDFLVGNSGSEVHRESH"
FT   gene            complement(487761..488645)
FT                   /locus_tag="NGR_c04340"
FT   CDS_pept        complement(487761..488645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04340"
FT                   /product="gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04340"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24230"
FT                   /db_xref="GOA:C3MGW5"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGW5"
FT                   /protein_id="ACP24230.1"
FT                   /translation="MTDLVPFSGRIVCDFASELGEGPTYDPATDTAWWFNIKGQELHEL
FT                   HLDSGRKTIHPLPFLGSVLATIDPGLQLIASDQGLFVRDTASFELSPFAALEDKPGNRS
FT                   NDGRVHASGSLWIGTMGRRAEKHAGAIYHVAGNRVTKLYGNITIPNGICFSPDGATAYF
FT                   TDTDVNHLMRVSIDPATGLPTGDPAVLSDESAAPGGIDGSVCDADGLIWNSRWGAGAVE
FT                   VYKPDGRKVARYAVPATQPSCPAFIGTKADRLLVTSAWQDLDDAARSADPNAGKTFELG
FT                   IEVKGRFEPAFQL"
FT   gene            complement(488642..489283)
FT                   /gene="dgoA"
FT                   /locus_tag="NGR_c04350"
FT   CDS_pept        complement(488642..489283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgoA"
FT                   /locus_tag="NGR_c04350"
FT                   /product="keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate
FT                   aldolase"
FT                   /EC_number="4.1.2.21"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04350"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24231"
FT                   /db_xref="GOA:C3MGW6"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031338"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGW6"
FT                   /protein_id="ACP24231.1"
FT                   /translation="MMNRIPLPPMKYPLIAILRGLKPEETGSVVGALIEAGFTAIEIPL
FT                   NSPDPFRSIETAVKMAPGHCLIGAGTVLTTEQVEQLDDVGGRLMVSPNVEPSVIRLAAA
FT                   KGMVTMPGVFTPTEALAAAAAGASGLKFFPASVLGPSGIGAIRAVLPGDLEIAAVGGVS
FT                   ETNFGDYAKIGVRSFGLGSSLYKPGMSAADVRQRAVATLAAYDAVYGGPR"
FT   gene            complement(489293..490210)
FT                   /gene="dgoK"
FT                   /locus_tag="NGR_c04360"
FT   CDS_pept        complement(489293..490210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgoK"
FT                   /locus_tag="NGR_c04360"
FT                   /product="2-dehydro-3-deoxygalactonokinase"
FT                   /EC_number="2.7.1.58"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04360"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24232"
FT                   /db_xref="GOA:C3MGW7"
FT                   /db_xref="InterPro:IPR007729"
FT                   /db_xref="InterPro:IPR042257"
FT                   /db_xref="InterPro:IPR042258"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGW7"
FT                   /protein_id="ACP24232.1"
FT                   /translation="MTAGYYAAVDWGTSSFRLWLIGEDGAALAERRSAEGMTTAARTGF
FT                   HAVLDSHLAAVSAPAHLPIIICGMAGARQGWKEAGYLETPAALGAIAGHAIAVPDVDRD
FT                   IRILPGLAQRDGRHPDVMRGEETQLLGAAGMLDHGRHLVCMPGTHSKWVRLSGQTVDGF
FT                   STFMTGELFDAISKHTILSHAVAEADAIAADSAAFADAVTRARENPALATNLLFSVRAG
FT                   QLLHGLSAADAKARLSGTLIGLEIAGALASAGSVDGICLVGSGRLGALYRSALESQGIA
FT                   VRLVDADEAVRAGLSAAAQAIWPL"
FT   gene            complement(490210..490980)
FT                   /locus_tag="NGR_c04370"
FT   CDS_pept        complement(490210..490980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04370"
FT                   /product="short-chain dehydrogenase/reductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04370"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24233"
FT                   /db_xref="GOA:C3MGW8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGW8"
FT                   /protein_id="ACP24233.1"
FT                   /translation="MTPPSSQFPDLRDRGVLVSGGGSGIGAALVEGFLRQGARVAFIDI
FT                   AEDSSRTLADKLAAETGQRPEFIHADLADVEQAKNAADAAVAALGPIGVLVNNAARDDR
FT                   QPLEAVTKESWDDSLAVNLRHFFFLSQAVAPHMRQAGGGSIINFSSIAFKLNMPEIPAY
FT                   ATAKAGIIGLTKSLAGKLGPDNIRVNAILPGMIVTERQRRLWLTEETIAGMQNRQCLKR
FT                   MLVAEDLVGPCLFLASDCSGAMTAQTMIIDGGVF"
FT   gene            491123..491920
FT                   /locus_tag="NGR_c04380"
FT   CDS_pept        491123..491920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04380"
FT                   /product="putative IclR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04380"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24234"
FT                   /db_xref="GOA:C3MGW9"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGW9"
FT                   /protein_id="ACP24234.1"
FT                   /translation="MTDLESEGPGTGTLGKALAVLEAVAAADRPQRFTDILQSVRQPRG
FT                   TLHRLLGHLVDEGLLVQRGDLSYEPGLRLLKLAYRSWSGNQFRDIAEPHLLRLHELTGE
FT                   TVHLGILRETEIIYVDKVESRQTVRMSSQIGKASPAYCTGIGKAALSSLAQGELERIAA
FT                   KTQFVPFTQRTHRSAISLLAEIEEIRRDGHAFDREEHEAEICCVAAPIVVREHELVAGV
FT                   SVTGPSYRVTMTQLAAWAADVRNAAAKIEEEARIRLGPGRGGR"
FT   gene            492122..492862
FT                   /locus_tag="NGR_c04390"
FT   CDS_pept        492122..492862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04390"
FT                   /product="putative LuxR/GerE family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04390"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24235"
FT                   /db_xref="GOA:C3MGX0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGX0"
FT                   /protein_id="ACP24235.1"
FT                   /translation="MMDFNADITSLVLPDGRSINDAIGNEDDVKRVLDQISDAFGFRGF
FT                   MVLAIPDSGCHSLAAQALLTSWPMEFLRRYDSAGLIEGSPVIQRLRRSTIPFTYDAHLL
FT                   ARRRVDGKGEAAISVFEAAGMPRGLYLPVHDAKGGRAAIAFGGDREVVSSDEMQALNFW
FT                   AGLLYSRLSEVRTHDRRRPGSLSRREIECLRWAAAGKTTVEMARIMALSEYTVNHYLNR
FT                   ATRKLDSVNRVQTVAKAMRAGLIN"
FT   gene            493000..493773
FT                   /locus_tag="NGR_c04400"
FT   CDS_pept        493000..493773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04400"
FT                   /product="putative LuxR/GerE family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04400"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24236"
FT                   /db_xref="GOA:C3MGX1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGX1"
FT                   /protein_id="ACP24236.1"
FT                   /translation="MSWNARMQDTMTTGMTDVELPRGGDFASEIAKLETQFDIIRYMRR
FT                   ITHIFGFKTFLICSIPPIDMERLSAATVISNMPAELLNKYDSLSMLRFSTGVRRLRETT
FT                   TPFQITLEDWESEGGTPDSAADYIVMLRENGIFQANYFPVHDAEGGRGAVILMGPEADL
FT                   PMTAAMELQMIAIHVYNRLAEIGSVWKSSSTTLSEREIQCLSWTAAGKTSAEIAGILGL
FT                   SEHTVNHYLNHVTKKLDAVNRTQAVVKAMKKGYIS"
FT   gene            494233..495384
FT                   /locus_tag="NGR_c04410"
FT   CDS_pept        494233..495384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04410"
FT                   /product="putative ATP-binding Mrp family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04410"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24237"
FT                   /db_xref="GOA:C3MGX2"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGX2"
FT                   /protein_id="ACP24237.1"
FT                   /translation="MPDVTREMVLEKLRGVRGPDMEGNIVDLGLVSDVFISDGKAYFSI
FT                   TVPADRAKELEPMRAAAERVVREIPGVKAAMVALTADRKAAPQAAPVQRPAPPSGHAHA
FT                   PRPAGGAPAKAGIPGVGAIIAVASGKGGVGKSTTSVNLALALQANGLKVGLLDADIYGP
FT                   SMPRLLKISGRPQQIEGRLIRPMENYGLRVMSMGFLVDEEVAMIWRGPMIQSALLQMLR
FT                   EVAWGELDVLVVDMPPGTGDAQLTMAQQVPLAGAVIVSTPQDLALADARKGITMFRKVE
FT                   VPVLGIVENMSYFVAPDTGNRYDIFGHGGARKEAERIGVPFLGEVPLTMGIRETSDAGT
FT                   PLVVSDPDGEVARIYRGIAERVWEQLSAGQGSKSRAMPNIVFE"
FT   gene            495547..495732
FT                   /locus_tag="NGR_c04420"
FT   CDS_pept        495547..495732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04420"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24238"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHB0"
FT                   /protein_id="ACP24238.1"
FT                   /translation="MPCRSRRGRCLALLAGDFCPDDDQAEMSWGESLHQMNRHCGNPVA
FT                   ADRFNSSWFASQKAAA"
FT   gene            495702..496706
FT                   /locus_tag="NGR_c04430"
FT   CDS_pept        495702..496706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04430"
FT                   /product="putative magnesium/cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04430"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24239"
FT                   /db_xref="GOA:C3MHB1"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHB1"
FT                   /protein_id="ACP24239.1"
FT                   /translation="MVRLPKGGRMISGYCVNGEAVALSTAEPPAALRPEIVWIDLVEPT
FT                   RAEELMMEGLLGISIPTRDDLKGIEPSSRLYVEDGAVFMTASLIYRSETQIAGLTDVGF
FT                   ILSGGRLVTIRYAEPRVFGLFKAGLHRIPGGCRNGVVILTRLLETISDRTSEILEQAVD
FT                   KIDDLSIEVFGDRAAGRRRPPQLLEARLRDVAGFHRLVAKTRDSLASLSRLLTFLYTVP
FT                   EVQEDKYSRELCRSISRDIQSLSEHAAFISGNITFLLDASLGLINVEQNAIIKIFSIAS
FT                   VVLLPPTLVASVYGMNFRVMPELEWQFGYPWALAAMVLSAIIPFFFFRWKGWL"
FT   gene            496722..498623
FT                   /locus_tag="NGR_c04440"
FT   CDS_pept        496722..498623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04440"
FT                   /product="potassium transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04440"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24240"
FT                   /db_xref="GOA:C3MHB2"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHB2"
FT                   /protein_id="ACP24240.1"
FT                   /translation="MSQSSAPAVHGSENARRLLALALGSIGVVYGDIGTSPLYAFREAL
FT                   RPLAHDGVTDVEIIGLISMMIWSLTIIVTIKYVLFLLRADNQGEGGTLSLLALLMKTAN
FT                   GHTWLLFFMGVAGAALFIGDAMITPALSVLSAVEGLKLVTPALSDYVVPIAVVILLLLF
FT                   AVQSKGTAAVSNFFGPITLVWFLVMGGIGLVHIADDLSIFSAFNPFYAATFLFNEGYVG
FT                   VIVLGAVFLTVTGAEALYADLGHFGRRPIQWAWFVIVFPALTLNYLGQGAFILEHPEAM
FT                   SDPFFLMFPKWALLPVVILATAATIIASQAVITGAFSLTRQAIHLGFLPRMAIFHTSET
FT                   HTGQIYLPNVNTLLMFGVMALVFVFGSSEALATAYGISVTGAMVVTTLLAFEFLRARWN
FT                   WSAWWAAAALLPLLALEFVFLGANMLKIHDGGYVPILIAATFIIVMWTWKRGTQILHAK
FT                   TRHIDIPLASFIKSIERKSEHAPVAVPGTAIFLTSDPDSTPAALLHNIKHNHVLHQQNF
FT                   ILTVRTANTPKVPKEERVSVRPLSERFTLLEMKFGYMETQNVSQALGLFRKSGLKFDIM
FT                   STSFYLGRRKLVPDAQSGMPHWQDRLFIALANAAIDPSDYFRLPTNRVVELGSHVII"
FT   gene            498813..499988
FT                   /locus_tag="NGR_c04450"
FT   CDS_pept        498813..499988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04450"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04450"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24241"
FT                   /db_xref="GOA:C3MHB3"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHB3"
FT                   /protein_id="ACP24241.1"
FT                   /translation="MVRRKSRRKFRMSFSAWRAPALIGLAIFLGFPSVAAYSDLATFLS
FT                   GINRGGERWRMYLTRSPAGSVHDVDMVFADPVTTGGLDGGAGMTLSDGRRVALTAETKH
FT                   QGGAPDEDRVTRKLKKGRIVAVSPVTPPKDFSAGSILKRTSFLIGPDFDGADKMAFAKP
FT                   KIKGKEIEIATAFYRRTPPKPDPGVSPVLAKLVTNREADILATAYVRPEPDYARESPFD
FT                   SILREDKTGGRFIPDIAPDDHAWAATALPATVFSKEEQTCLAEGIYFEARSESVKGQAA
FT                   VAQVILNRVRNPTYPKTICGVVYQNKAWRNRCQFSFACDMIRDLIYSRSHWKTAKEVAM
FT                   AVTAGKVWLPEVGSATHYHATYVKPAWAKTMKRVGQIGLHIFYRTYGGGWS"
FT   gene            500210..500635
FT                   /locus_tag="NGR_c04460"
FT   CDS_pept        500210..500635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04460"
FT                   /product="putative ATP synthase protein I"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04460"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24242"
FT                   /db_xref="GOA:C3MHB4"
FT                   /db_xref="InterPro:IPR016989"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHB4"
FT                   /protein_id="ACP24242.1"
FT                   /translation="MSTGRLYDRDRVRPRGAAKGSHVTEKPEESLEARLKRLGEDIASK
FT                   RVDVSDEAEVRSAESRKGYAAAMKLSSEFIAGIVVGAFLGYLLDHFAGTGPWGMIVLLL
FT                   LGFCAGVLNVLRSAGLVATPDQRGGSPGNSKKDGDGA"
FT   gene            500696..501448
FT                   /gene="atpB"
FT                   /locus_tag="NGR_c04470"
FT   CDS_pept        500696..501448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="NGR_c04470"
FT                   /product="ATP synthase A chain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04470"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24243"
FT                   /db_xref="GOA:C3MHB5"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MHB5"
FT                   /protein_id="ACP24243.1"
FT                   /translation="MSNDPTHQFLVNKIVPIEIGGIDFSFTNASLFMVATVGVAAGFLY
FT                   LTTSQRGVIPTRMQSVSEVSYEFIASMLREGAGSHGMKFFPMVFSLFMFILTANLLGMF
FT                   PYFFTVTSQIIVTFALAVFVIGTVILYGFYKHGFGFLKLFVPHGVPGALLPLVVSIEVI
FT                   SFLSRPISLSVRLFANMLAGHITLKVFAGFVASLSAFGALGIGGAILPLIMTVALTGLE
FT                   FLVAFLQAYVFAVLTCMYLNDAVHPGSH"
FT   gene            501533..501760
FT                   /locus_tag="NGR_c04480"
FT   CDS_pept        501533..501760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04480"
FT                   /product="ATP synthase, subunit C"
FT                   /EC_number="3.6.3.14"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04480"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24244"
FT                   /db_xref="GOA:C3MHB6"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHB6"
FT                   /protein_id="ACP24244.1"
FT                   /translation="MEAEAAKFIGAGLACLGMAGTALGLGNIFGSYLSGALRNPSAADG
FT                   QFGRLVFGFAVTEALGIFSLLVALLLLFAV"
FT   gene            501842..502453
FT                   /gene="atpF2"
FT                   /locus_tag="NGR_c04490"
FT   CDS_pept        501842..502453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF2"
FT                   /locus_tag="NGR_c04490"
FT                   /product="FoF1 ATP synthase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04490"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24245"
FT                   /db_xref="GOA:C3MHB7"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHB7"
FT                   /protein_id="ACP24245.1"
FT                   /translation="MTAAYAQQSTTTEGAEAHDAPAAGEVHTETGVAHEAEHGSGVFPP
FT                   FDSSHFASQLLWLAITFGLFYLLMSKVIIPRIGGILEKRHDRIAQDLDEASRLKGEADA
FT                   AIASYEQELANARAKGHSIADTAREEAKSKATADRAAVEAELTKKITAAETRIADIKSK
FT                   ALADVGAIAEETATAVVKQLIGGNVTKTEIAAAVKASAGN"
FT   gene            502467..502952
FT                   /gene="atpF1"
FT                   /locus_tag="NGR_c04500"
FT   CDS_pept        502467..502952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF1"
FT                   /locus_tag="NGR_c04500"
FT                   /product="Fo ATP synthase B chain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04500"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24246"
FT                   /db_xref="GOA:C3MHB8"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHB8"
FT                   /protein_id="ACP24246.1"
FT                   /translation="MALDATFYALVGLILFLALIAYLKVPGKIAEALDARADKIGNELA
FT                   EAKRLREEAQSLVAEYQRKRKDAEAEAANIVAAAQREAEMLTAEAKQKTEDYVARRTAL
FT                   SEQKIKQAESDAINAVRTAAVDLAISAAEKVLATKADATAQETLFKQALGEVKGRLN"
FT   gene            503183..503833
FT                   /locus_tag="NGR_c04510"
FT   CDS_pept        503183..503833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04510"
FT                   /product="glutatione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04510"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24247"
FT                   /db_xref="GOA:C3MHB9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHB9"
FT                   /protein_id="ACP24247.1"
FT                   /translation="MAITITAFERSPDGGKGLARDMRVRWALEEVGQPYDVRLLSFKAM
FT                   KEPAHRALQPFGQIPTYEEGDLALFESGAIVLHIAERHAGLLPGNANARARAIAWMFAA
FT                   LNTVEPPIFDRALARILERDEPWYDQRLGVLEDSIRKRLSDLSSRLGVADWLDGAFSAG
FT                   DLLMVTVLLRLKGSGMLDEFPNLSAYVARGEARPAYKRAFDAQLAVFTAASTG"
FT   gene            complement(504095..504790)
FT                   /gene="rnhB"
FT                   /locus_tag="NGR_c04520"
FT   CDS_pept        complement(504095..504790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="NGR_c04520"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04520"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24248"
FT                   /db_xref="GOA:C3MHC0"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MHC0"
FT                   /protein_id="ACP24248.1"
FT                   /translation="MSRRKSPDSPLFQLEPVLPDFSFEITAKRDGFWPVAGADEAGRGP
FT                   LAGPVVAAAVILDPDAVPGGLNDSKLLTAEQREALFTEIMATATVSIASSSAAHIDATD
FT                   ILKASLDAMRRAIDGLSIAARFALIDGRDVPQGLPCHAKAIVKGDSRSVSIAAASIVAK
FT                   VTRDRMMARADATFPAYGFALHAGYATVRHRSAIDSHGPCSLHRMSFRPFREAQEQPLA
FT                   VSTGPIDPN"
FT   gene            complement(504972..506129)
FT                   /locus_tag="NGR_c04530"
FT   CDS_pept        complement(504972..506129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04530"
FT                   /product="radical SAM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04530"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24249"
FT                   /db_xref="GOA:C3MHC1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHC1"
FT                   /protein_id="ACP24249.1"
FT                   /translation="MTELSQLRQGAFAPGNSAELAEAIVTGTGVRIEIDRRRGRGAALN
FT                   MSGRYEPRTRDAFDDGWQTIEELPPFKTEVQVEKPRNVITRNESPDISFDRSINPYRGC
FT                   EHGCIYCFARPTHAYMGLSAGLDFEAKLFAKPDAPRLLERELAKPDYKVRPIAIGTNTD
FT                   PYQPIEKEWRIMRQILEVLKAANHPVMIVTKSAMVTRDIDLLAPMAEKGLARVGISVTT
FT                   LDRKLARAMEPRASTPPKRLEAIRAVSEAGIPAGVLVAPIIPALNDHEIERVLDAAKTA
FT                   GAAEASYVLLRLPLEVSPLFRDWLLRNYPDRYRHVMSLVRSMRGGKDYDAEFGKRMKGA
FT                   GPYAWQIGRRFELAAKRLELNLTRRQLRHDIFVPPLGMGVQLSLL"
FT   gene            506305..506838
FT                   /locus_tag="NGR_c04540"
FT   CDS_pept        506305..506838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04540"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04540"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24250"
FT                   /db_xref="GOA:C3MHC2"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHC2"
FT                   /protein_id="ACP24250.1"
FT                   /translation="MLTIIMETRDNEAELAQTLSVLVAGAVEGLVSDVIILDHGSSDGS
FT                   AHVADAAGCRFCAEWDLSDVVRSARGDWLMLLEPGARPIGRWVDELIEYVSLNKDPARF
FT                   SPSRMHRRPLLKRLSQRAAPLEAGFLMRKQDAVAAARANMQLSDMATARAVRKLATELV
FT                   PAWVALGHRSAERA"
FT   gene            complement(507121..507663)
FT                   /locus_tag="NGR_c04550"
FT   CDS_pept        complement(507121..507663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04550"
FT                   /product="putative molybdenum cofactor biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04550"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24251"
FT                   /db_xref="GOA:C3MHC3"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR013484"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHC3"
FT                   /protein_id="ACP24251.1"
FT                   /translation="MPGIDEARPFIPVGIAVLTVSDTRTRADDKSGDTLEASIRDAGHR
FT                   LEARAIVRDDRREIYDQVKAWTLDASIDVVITTGGTGFTGRDVTPEALEPLFEKRMDGF
FT                   SEVFHRISYDKIGTSTIQSRATGGVANATFIFVLPGSPGACKDAWDGILKQQLDYRHMP
FT                   CNFVEIMPRLDEHLKRG"
FT   gene            complement(507667..508635)
FT                   /gene="ispE"
FT                   /locus_tag="NGR_c04560"
FT   CDS_pept        complement(507667..508635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="NGR_c04560"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="CMK;
FT                   4-(cytidine-5-diphospho)-2-C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04560"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24252"
FT                   /db_xref="GOA:C3MHC4"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHC4"
FT                   /protein_id="ACP24252.1"
FT                   /translation="MPRRRCRRSPPRRTRNPDSMPADGIAGFALTLAAPAKINLALHVV
FT                   GQRADGHHLLESLVTFAECGDRIAFAPADADHFTVSGPFSRDLPVSADGKSGNLVLRAR
FT                   DLLRRELIGRGAPTTSVHLHLEKNLPIASGIGGGSADAAATLRGLLSLWKAEIAPERLA
FT                   SLALELGADVPMCLDGRPLLARGIGEEIAPLADLPSFAIVLVNPLVAVSTPVIFRMLAE
FT                   KRNPPLALPHGAHTAAAWLAALADMRNDLERPARALEPAVETVSDALQAVRADLVRMSG
FT                   SGATCFGLFDSDEKAGAAAQRISADQPGWYVLATRTAGKRG"
FT   gene            complement(508583..510403)
FT                   /locus_tag="NGR_c04570"
FT   CDS_pept        complement(508583..510403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04570"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04570"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24253"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHC5"
FT                   /protein_id="ACP24253.1"
FT                   /translation="MRHNTFLRLLGGAAMLALLCVTGSHQAFAEDKAAVEDARPFDIRG
FT                   VNTFAGAFLAARTADVDRDFETATELYRIALRFEPENTEVKQRLMITLLMSGKFDEGVK
FT                   IAEALKSDPAVERITTTVRAIESIRKREYRSAQKLLNYQGPNDLDRLMSTLLSAWAKAG
FT                   QGRPKEAIAQIKALEGPEWFRVFKNYHTGAIALVAGDKTTARSRLNDAILDREGGSAAP
FT                   DTFMRAVEALARFEAREGNKQKALDTVSVGESLVNNYTPLEALRESIEKGEPQEQQVRN
FT                   AAQGAAAVLFSIGGALNREGAEDIVTLYLQTARRLDPESADILVMLGGIAENLKKQDEA
FT                   IALYKSVPAESPMRRVSELQLGLALASVGKVDEAKKHLQALIEVDPKNIRNYLAYGSVL
FT                   SDAKAYKEMGDLYDRAVEAIGPVPKRSDWTVFFQRGIAYERQKIWEKAEPSFLKALELN
FT                   PNQPQVLNYLGYSWVDMNINLDKGLEMIRKAVELKPDDGYIVDSLGWAYFRMNRFDEAV
FT                   TELERAAELMAGDPTINDHLGDAYWRVGRKLEAVFQWNQALEMKPEEAEVSKIKAKIEN
FT                   GLPALKQDVPAAADAKETLPKKPAAPDKKS"
FT   gene            complement(510570..511586)
FT                   /gene="ispB"
FT                   /locus_tag="NGR_c04580"
FT   CDS_pept        complement(510570..511586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispB"
FT                   /locus_tag="NGR_c04580"
FT                   /product="octaprenyl-diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04580"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24254"
FT                   /db_xref="GOA:C3MHC6"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHC6"
FT                   /protein_id="ACP24254.1"
FT                   /translation="MGVVIPLEDNKNKQASVKPLVGLTAADMERVNQLILSKAGSDVQM
FT                   IPEVANHLISSGGKRLRPMLTLAAASMFGYEGDAHVKLATSVEFMHTATLLHDDVVDES
FT                   DLRRGKSTARTIWGNQASVLVGDFLLGQAFRMMVDVGSLDALDVLSTAASVIAEGEVLQ
FT                   LSVAKNMETTEDDYLQVIRAKTAALFAAAAEVGPIVASASRADRNALKSYGMNLGLAFQ
FT                   LVDDVLDYGGSSSDLGKNVGDDFREGKITLPVILSYRRGTPEDRAFWREAIEGGVTDAA
FT                   NLDKALGLIRRYGGLTDTIARAQHYGTIARDALAPLPASPWKSALVEVIDFCIDRVS"
FT   gene            511699..511920
FT                   /locus_tag="NGR_c04590"
FT   CDS_pept        511699..511920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04590"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24255"
FT                   /db_xref="GOA:C3MHC7"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="InterPro:IPR036675"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHC7"
FT                   /protein_id="ACP24255.1"
FT                   /translation="MKELIRTNDAVLLSFAESLMKDAGIPCLIADRDMSILEGSLGLLP
FT                   RRFLVADDDADRARRILIDAGLEKELRQ"
FT   gene            511970..512743
FT                   /locus_tag="NGR_c04600"
FT   CDS_pept        511970..512743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04600"
FT                   /product="putative methyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04600"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24256"
FT                   /db_xref="GOA:C3MHC8"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHC8"
FT                   /protein_id="ACP24256.1"
FT                   /translation="MTTTAESVDSFHRGKFHLIQPLGQGHRSGMDAMLLAALVSCERPC
FT                   RVADLGAGAGAAGMAVASRLAEAEVLLVERSAIMADFARRSLALPENARFASRVAVLEA
FT                   DVSLNGKARAAVGLPDDAFDHVIMNPPFNDAADRRTPDSLKAEAHAMSDDLFETWIKTA
FT                   GAIMKPGGQLSLIARPESIAEIIAACGRRFGGIEITPLLPRAGENAVRILVTAIKQSRK
FT                   RLVLRAPLIMHAEGTHRFSPEIDDLNNGREAYRRR"
FT   gene            512822..513688
FT                   /locus_tag="NGR_c04610"
FT   CDS_pept        512822..513688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04610"
FT                   /product="putative peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04610"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24257"
FT                   /db_xref="GOA:C3MHC9"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHC9"
FT                   /protein_id="ACP24257.1"
FT                   /translation="MAGFFRKLMPRRFRRDGIAIPTIRLHGTIMSGGGQFRPVLNLATV
FT                   APLLEKAFSVKEAPAVAISVNSPGGSPVQSRLIYQRIRDLADEKKKRVLIFVEDVAASG
FT                   GYMIALAGDEIIADPSSIVGSIGVVSGGFGFPELLKKVGVERRVYTAGENKVVLDPFQP
FT                   EKERDVEFLKSLQLDIHDTFIQLVKARRGSMLADHPDIFSGLFWTGRRGQELGLVDALG
FT                   DMRGEVKRRYGEKARLELIQPSRSLFGRRQPGAAVGGSIAAPLAASAAAGLLEAIEERA
FT                   LWARFGL"
FT   gene            513831..514022
FT                   /locus_tag="NGR_c04620"
FT   CDS_pept        513831..514022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04620"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24258"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHD0"
FT                   /protein_id="ACP24258.1"
FT                   /translation="MPQIILLLIVALIAWIGYRKFIADAQKVTRHQERLRRERETGANG
FT                   TLVKDPKTGEYRLKREDE"
FT   gene            514128..515090
FT                   /gene="glyQ"
FT                   /locus_tag="NGR_c04630"
FT   CDS_pept        514128..515090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="NGR_c04630"
FT                   /product="glycyl-tRNA synthetase alpha chain"
FT                   /EC_number="6.1.1.14"
FT                   /note="glycine--tRNA ligasealpha chain; GlyRS"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04630"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24259"
FT                   /db_xref="GOA:C3MHD1"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHD1"
FT                   /protein_id="ACP24259.1"
FT                   /translation="MTTASLPDHMNPKRSFQALILTLHSYWADKGCAVLQPYDMEVGAG
FT                   TFHPATTLRALGPKPWRAAYVQPSRRPTDGRYGENPNRLQHYYQYQVLLKPNPSNLQEL
FT                   YLGSLEAIGLDPLLHDIRFVEDDWESPTLGAWGLGWECWCDGMEVSQFTYFQQVCGIEC
FT                   SPVSGELTYGLERLAMYVQGVDNVYDLNFNGREGAEKITYGDVFLQAEQEYSRHNFEYA
FT                   NTAMLHQHFVDAEKECLALLAAGAPGDASNNRLHKCVLPAYDQCIKASHVFNLLDARGV
FT                   ISVTERQSYILRVRTLAKACGEAFLLTDAGGANETRDAA"
FT   gene            515172..515711
FT                   /locus_tag="NGR_c04640"
FT   CDS_pept        515172..515711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04640"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24260"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHD2"
FT                   /protein_id="ACP24260.1"
FT                   /translation="MLHAEEFAAFEPPHRFQRHGGADRQFAGIDLQGAANAGWPLDRCC
FT                   ARMGSEEGREGDNVDEGGERSHGPVCMLWLFDCLSIGHKCRSRRYRRNSSALAKWDRLQ
FT                   RLDTAAAISRPGVLTVERVDHGWLRIEAGKDMLFAGASCISHAESVLTSGGFRRRAFHD
FT                   RAGNRGRRDPLPGFRL"
FT   gene            515656..516204
FT                   /locus_tag="NGR_c04650"
FT   CDS_pept        515656..516204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04650"
FT                   /product="LemA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04650"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24261"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHD3"
FT                   /protein_id="ACP24261.1"
FT                   /translation="MIGLAIGVAVILYLVFVYNGLVKARQMAEEAWSGIDVQLKRRADL
FT                   IPNLIETVKGYAAHEKSTLEEVVALRNRAQAVPEGDIAARAAAEGALSQALGRLFALAE
FT                   AYPDLKANENFVELQRSLETIEGEIQMSRRYYNGAARDLNVKVESFPSNLIAGTFRFAK
FT                   ASYFEITNEADRAVPSVKF"
FT   gene            516229..518166
FT                   /locus_tag="NGR_c04660"
FT   CDS_pept        516229..518166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04660"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24262"
FT                   /db_xref="GOA:C3MHD4"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHD4"
FT                   /protein_id="ACP24262.1"
FT                   /translation="MKRLLAALAFVLMVLAAPCPAAAEEIISSYHSVIDVAKDGTLTVT
FT                   ETITANVEGNQIRRGIYRDFPLTFIDPDGRRVRVDFKLVSVERDGEQEEYRTESISGGI
FT                   RIYTGNADVFLPRGEHIFQLTYETSRQIRFFNDHDELYWNVTGTEWAFPIEEATATVTL
FT                   PDGVVAQALDVFTGGYGATGKDARAVEEGGEIFFATTRRLRPQEGLTIAIKLPKGSIDR
FT                   PSPSQQNIWWLRDHLAVVIAGAGLVAVGLYYGRAWVRVGRDPARGVMVPRWDPPDGISP
FT                   ALVNYIDNKGFSGEGWTALSAAALSLAVKGYVVLDDLKNAIIVSATGKSGGEKLPTGEA
FT                   ALMKSVEAAGGTLKIDRANGKAVADAGSSFRSAMEREHRGKYYQANVGYITGGVVLSIV
FT                   ALAALFIFGELGEETIPFIVVPVFVAVFVSGFAVSVGKSLRRGSSLMRRIMSIVVLAFI
FT                   GFVLVAVFSSILAVVMFSATEPDDLPLFFAVGGIVLVNGLFYYLMGAPTPLGTRMMDGI
FT                   DGLRQYLTLAEQDRLNMQGVPEMSPRHFETLLPYAVALGVEKPWTETFDRWLLAAAGGA
FT                   AAAAYQPSWYHGDSFGPGSFSDTIGGFAGSMADTMTSSLPPPPKSSSSGFSSGGGFSGG
FT                   GGGGGGGGGW"
FT   gene            518262..520427
FT                   /gene="glyS"
FT                   /locus_tag="NGR_c04670"
FT   CDS_pept        518262..520427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="NGR_c04670"
FT                   /product="glycyl-tRNA synthetase beta chain"
FT                   /EC_number="6.1.1.14"
FT                   /note="glycine--tRNA ligasebeta chain; GlyRS"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04670"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24263"
FT                   /db_xref="GOA:C3MHD5"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MHD5"
FT                   /protein_id="ACP24263.1"
FT                   /translation="MPDLLIELRSEEIPARMQRKAAGDLKKLVTDALVEAGLTYEGARE
FT                   YWTPRRLTLDIRGLNARSADVREERKGPRTDANEKAIEGFLRAAGLSSIGDAHVHSDPK
FT                   KGDFYVAHIVKPGRDAEDIVAEVMPAIIRDFPWPKSMRSGAASAKPGSLRWVRPLQSIV
FT                   CTFGAETEETRVIPFAVDGITASNITYGHRFHAPEAIMVRRFADYADKLEKAKVVLDAE
FT                   RRKEIIGADARNIAFANGLELVEDEGLLEEVTGLVEWPRVLMGSFEESYLEIPSEIIRL
FT                   TIKTNQKCFVTRQPGAETLSNRFILVSNIEAKDGGKEIVHGNGKVVRARLSDAAHFWKR
FT                   DQGDLPDLETLKPSAEKFGLDLGKPLDQRMAKLDALNVTFHAKLGTQGERVARIRSIAL
FT                   ALAEVTGADQALVERSVVLAKADLRTEAVGEFPELQGIMGHKYAVLQGEDAAVANAIED
FT                   HYKPQGPSDRVPTDAVSAAVALADKLDTLAGFWAIDEKPTGSKDPYALRRAALGVIRLI
FT                   LEGRTRLPLLPFFDVALKALRTQRPDLTGDIAADLLAFFHDRLKVYLRDLGARYDLIDA
FT                   VLTSEADDLLMIARRVEALTAFITAEEGKNLLAGTKRATQILAAEEKKGTEVADQVDER
FT                   LFRLDAERTLHASIKLASDDAREAIGKEDFRSAMAALSKLREPVDVFFNDVLVNDEDRA
FT                   IRANRLALLGLIRSATGEVADFSKISG"
FT   gene            520488..521360
FT                   /locus_tag="NGR_c04680"
FT   CDS_pept        520488..521360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04680"
FT                   /product="putative AraC-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04680"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24264"
FT                   /db_xref="GOA:C3MHD6"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHD6"
FT                   /protein_id="ACP24264.1"
FT                   /translation="MTSDHPSAGAGVIDPPGRNGRGDWIALAEDVIPFERIEAFFAGRA
FT                   YEPHRHDTYAVGQTLSGVQSFRYRGAERTSLPGRTMVLHPDELHDGQAGAEEGFRYRMI
FT                   YIEPAAIQEVLGGRPLPYVRGGVSSDPRLFAAVHALLPATDARIDALEFEDGLFELAHA
FT                   LQAAAGGPVKVGGALDYRAAERARLYLHELPEGTVTLERLEAVSGRDRWGLSRDFRRLF
FT                   GTSPYRYLVQRRLEAVKADLRQGVPAAEAALDAGFADQAHMSRHFKKAFGVAPGRWLRM
FT                   AGMPAGEQA"
FT   gene            521440..521820
FT                   /locus_tag="NGR_c04690"
FT   CDS_pept        521440..521820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04690"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24265"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHD7"
FT                   /protein_id="ACP24265.1"
FT                   /translation="MNLSSRTYAPINFADKLAKFADQWQPRVIAELNDYQFKIVRIEGD
FT                   FIWHDHPETDEAFIVLEGTLRIDFREGSVTLGPGEMYVVPKGVEHKPFAASEVKMLLIE
FT                   PAGTLNTGQAGGERTAASDVWI"
FT   gene            521835..522044
FT                   /locus_tag="NGR_c04700"
FT   CDS_pept        521835..522044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04700"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24266"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHD8"
FT                   /protein_id="ACP24266.1"
FT                   /translation="MVGDLVFLLLAALPLMGSPGPATLSLCGHGRRARHFPQPALCCRN
FT                   QCRYHKCGSVDCDGDDGHRAVCRE"
FT   gene            522047..522427
FT                   /locus_tag="NGR_c04710"
FT   CDS_pept        522047..522427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04710"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24267"
FT                   /db_xref="GOA:C3MHD9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHD9"
FT                   /protein_id="ACP24267.1"
FT                   /translation="MAATVIGGLYMLYLALRIATAPPVAAEQGTHLPSFLGGFVLAIAN
FT                   PKAYAAIGSLYVGSLVDAQQGTRAAVGSVVVLAFVAVALNTTWLAFGAAIAAVLRDPRK
FT                   ARIANLVFALLLLASLVPLLLS"
FT   gene            522473..522979
FT                   /locus_tag="NGR_c04720"
FT   CDS_pept        522473..522979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04720"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24268"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHE0"
FT                   /protein_id="ACP24268.1"
FT                   /translation="MTAKILVSACLMGHAVRYDGAAKPLCHPALERWRAEGRLVTLCPE
FT                   MSAGMPVPRPPAEIEAGKTGASILSGSGRVLEKTGSDVTEAFRHGAENALALARATNCR
FT                   FALLIDGSPSCGSSLVYDGSFNGERVRGEGVTAALLRRNGIEVFSDREVDMLVERLARD
FT                   DEAAP"
FT   gene            complement(523088..523585)
FT                   /locus_tag="NGR_c04730"
FT   CDS_pept        complement(523088..523585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04730"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24269"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHE1"
FT                   /protein_id="ACP24269.1"
FT                   /translation="MRSLLITAALTLAAGTATASSVEDVASGQAVNASVATISCAECPP
FT                   LQPKKKASYVVPELAPGTAKLEVKEINGEMKSVRTEAWLGGSPVVFVNKASEEAIKAAA
FT                   IKADPASAGAAEASVAAVADIDQTAKTAAVGIVSHAEPVSASMAGSGSQEFDPSGFELR
FT                   LD"
FT   gene            complement(523687..524958)
FT                   /gene="purD"
FT                   /locus_tag="NGR_c04740"
FT   CDS_pept        complement(523687..524958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="NGR_c04740"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="GARS; glycinamideribonucleotide synthetase;
FT                   phosphoribosylglycinamide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04740"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24270"
FT                   /db_xref="GOA:C3MHE2"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHE2"
FT                   /protein_id="ACP24270.1"
FT                   /translation="MKVLLIGSGGREHALAWKIAQSPQLTALYAAPGNPGIAEEATIVA
FT                   LDIDDHAAVVDFCRRESIDFVVVGPEAPLVAGLADALRAAGIATFGPSAAAAQLEGSKG
FT                   FTKDLCAKYAIPTGAYKRFTEAEPAKAYIREQGAPIVIKADGLAAGKGVTVAMTLDEAL
FT                   AAVDECFSGVFGAAGAEVVVEAYLDGEEASFFCLSDGKAVLPLASAQDHKRVGDGDTGP
FT                   NTGGMGAYSPAPVMTAGMVERTMQEIIEPTVRGMAESGYPFTGVFFAGLMITAKGPELI
FT                   EYNVRFGDPECQVLMMRMKSDLLPLLYAAATGTLDGKEIEWHDDAALTVVMASRGYPGS
FT                   YEKNTPIAALPDASAATKVFHAGTAIKDGRLVATGGRVLNVTAMGSTVSDAKDAAYAGV
FT                   NGVSWENGFYRRDIGWRAVAREKA"
FT   gene            complement(525048..527759)
FT                   /locus_tag="NGR_c04750"
FT   CDS_pept        complement(525048..527759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04750"
FT                   /product="c-di-GMP phosphodiesterase A-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04750"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24271"
FT                   /db_xref="GOA:C3MHE3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHE3"
FT                   /protein_id="ACP24271.1"
FT                   /translation="MAIFGPPGRDTFLARLRFGYRRFAAQAARPGVPRFHRFAGKRRCQ
FT                   CPGLDHADHEQRGVEAPAGGDAIRPGDLSAGHDPGEKPVPAGTLNPVGPSAPTHHQHIG
FT                   EFSVTLSKRALFLIFPVVLLGYLLAALSVYFAQERSIQALEKAKLSQRLEHAGAVFQNE
FT                   VQRSKSFLNALLNGNVLRQFVAETDERYRVTALGARLQESIKSLSEDPIAYISFAILNS
FT                   KAEPEYYYENGWDPFAEIDEPQRDLARKLLAGKRLSDLTYLEPTGDRPRIVFSLFVDPV
FT                   TFGRPMPSNKANALLMQIAVLPDRFLAMQAALKKEYGADIVLQPWPLAVTDRLSAGTPL
FT                   GTQLYATIVVPDAYFEAEVLRRKVLLACGALAMSLISIFLIVLLIRRFITGPIASLDAD
FT                   VTAVMNGERDDIRDMDEAGEIGRLTHNIRELHGQSAHSLRLVQQNSWTDTLTGINNRGR
FT                   FNALAAGVVEEAVASGEKCSLLFIDIDNFKFVNDKHGHDVGDDLLKTLAVRIGQTVEAI
FT                   TRRRQLEPAILARLSGDEFAVLVRSNPGEGTIREISNAILALFDGGFEVSGKSYPVTAS
FT                   IGVAICPDDATNIAELISNADAAMYQAKSGGRNRSSRFSRALHDKRTRLRQIQEELRGL
FT                   DPDEQFRLVYMPIVNVRGQVTGCEALLRWHSPILGAVTPDEFVPIAESSGLFTKIDWWV
FT                   INKAMSDCGQLKALFGQDTVLAINISSAELHSHALGDYLSDCAARHQLEPQSIDIELTE
FT                   TFAVKISDQLRQNIDELRHKGFRLSIDDFGAGYTSIQQIIDYAADTIKLDRALVTNLTA
FT                   SHSLSVLKAVVALCHAKDMAVIGEGVDTPEKLAMLTAAGCDRFQGYLISKPLSLDDLAI
FT                   WALTRTAQHVKDRPADERSVSARRSSSREARR"
FT   gene            complement(527435..528475)
FT                   /locus_tag="NGR_c04760"
FT   CDS_pept        complement(527435..528475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04760"
FT                   /product="putative spermidine/putrescine ABC transporter,
FT                   periplasmic spermidine/putrescine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04760"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24272"
FT                   /db_xref="GOA:C3MHE4"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHE4"
FT                   /protein_id="ACP24272.1"
FT                   /translation="MRRRAATSVFLATLLCAAASRAETLNLLIWEAYIDQGLIDRWTQK
FT                   TGVSIHQINFDSDDARDEVLADPSNNIDLVVVDENGAHLFGKKGVLETLNEANLPALAD
FT                   YAPEWRDRCAGSGLPYFSGTVGILYRSDVIAEPPTSWQELMRPAASLKKHVAMFDDHTE
FT                   LFVPPLMLLGASINTSDTGTLKAAFDLLKAQAPAVLTYDYVITAIQDQTSGKEIHMALG
FT                   YSGDQHVLNDKVSKPGLWRYSVPREGTLSWLDCVSVIAGSPRKQHALEFLDFIGSPESA
FT                   AANALALTMPTTSSAALKLLPEAMRSDPEIYPPATTLAKSQYQQELSIQSVQARRRIIS
FT                   TLANFQ"
FT   gene            complement(528584..529777)
FT                   /locus_tag="NGR_c04770"
FT   CDS_pept        complement(528584..529777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04770"
FT                   /product="putative transmembrane MFS family transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04770"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24273"
FT                   /db_xref="GOA:C3MHE5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHE5"
FT                   /protein_id="ACP24273.1"
FT                   /translation="MSSVTAGSINPEKTAFSVILAVSFCHMLNDIMQSLLTALYPLLKA
FT                   NYALDFVQIGLLTFTFQVTASMLQPAVGIVTDRWALPYTLPVAMLSTCSGLLLLAHADH
FT                   FWMLLIAASLIGVGSAIFHPESSRVARLASGGRHGLAQSLFQVGGNAGSALGPLLAAFI
FT                   VLPFGQGSLGWFSIVAITGFFVLSWVSTWYVRHRRSTMSRAAPNRALPLPKARVLWTVA
FT                   ILVLLTATKNVYLASVSSYFTFFVIEKFGTSVQQAQLMLFLFLGSAAAGTFLGGPIGDR
FT                   YGARFVIWLSILGVIPFALMLPYANLFWTGVLSVVIGLVFSSAFSAIVVFAQELVPGRV
FT                   GLIAGVFFGFAFGFGGMGAAVLGVFADSHGIEFVYQICSYLPLLGIFTVFLPKIPSR"
FT   gene            529887..530699
FT                   /locus_tag="NGR_c04780"
FT   CDS_pept        529887..530699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04780"
FT                   /product="putative AraC-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04780"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24274"
FT                   /db_xref="GOA:C3MHE6"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHE6"
FT                   /protein_id="ACP24274.1"
FT                   /translation="MPKSDRHYLPDLPDADHFRNLEWIEKANAPLLAIGRDYGRGLIVP
FT                   PHSHTRTQLWWARSGVVLVHTADGRWMIPPGHALLIPAGMEHSAEMVSDVRMHSIYIAA
FT                   MSRAHRPLVLEITALAGSLIDELVRIENETSSERREQLITDLLLEEIPRLAERPLGLPF
FT                   PQDRGLAGLCRKFLEAPSASANIDQWADNLGISRRSFTRFFRRETGISFVTWRQQACIF
FT                   ASLPRIADGEPITTVALDAGYENVAAFTTMFRRMLGAPPSLYLRGRDL"
FT   gene            530757..531716
FT                   /locus_tag="NGR_c04790"
FT   CDS_pept        530757..531716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04790"
FT                   /product="putative 4-hydroxybenzoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04790"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24275"
FT                   /db_xref="GOA:C3MHE7"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHE7"
FT                   /protein_id="ACP24275.1"
FT                   /translation="MNSSSVDSGRVHDAPSKNWVYRVLPRALWPYAQLARWDRPIGWQL
FT                   LMWPCLWSAALAGGAAAALGSFSPARFLFHVILFVAGAIAMRGAGCTYNDIVDHEIDME
FT                   VARTRSRPLPSGRVTRAQAKVFMVLQALVGLVVLLQFNAFTVFLGIASLGLVAIYPFAK
FT                   RFTDWPQFFLGLAFSWGAIMGWSAEFGSLSFAAVLLYAAAIAWTIGYDTIYAYQDREDD
FT                   ALIGVRSTARRFGDNPRPWLIGLYGLTILLMFLAFLAAGTGFFAHVGLVVAAVMLAYQI
FT                   LVLNIHDPEQCLALFKFNGVVGLIVFAGMVLALLPRLI"
FT   gene            complement(532034..532600)
FT                   /locus_tag="NGR_c04800"
FT   CDS_pept        complement(532034..532600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04800"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04800"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24276"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHE8"
FT                   /protein_id="ACP24276.1"
FT                   /translation="MRNTLSQPAWVGNTLRLDPKRFPQQATYVLRGDVGNVSISLDQRG
FT                   AVLRKVLPSSGLPLSIALPARAFKGVAARAIDHGDGEVTVTLELHHDDPDLCIPLLVAH
FT                   DLSDIAADWRAWAEAYRIPMLMVEADGVARPLEEHLGEIRTAPVKPRRRHSFFAERRPR
FT                   FLVRRSTGKLGVHMKIDGREIIARS"
FT   gene            532929..535238
FT                   /locus_tag="NGR_c04810"
FT   CDS_pept        532929..535238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04810"
FT                   /product="putative flagella associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04810"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24277"
FT                   /db_xref="InterPro:IPR010626"
FT                   /db_xref="InterPro:IPR023157"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHE9"
FT                   /protein_id="ACP24277.1"
FT                   /translation="MVSTYLDYNLIARDMKVSLKRVSEQTVVARDTQYYKENIGNVSSV
FT                   DAFLDDYRLYSYAMTAFGLGDMIDSVAFMRKVLESDLSDTSSFANSLTDDRYREFALAY
FT                   SFSGATAVSQTEAQLDEIIGLYDTSILNIAETQEEETRYYNVMIDKITSVDQLLNNDRL
FT                   RAYVFTAFGVDESTYSRQTIRSVLSSSSGDASSYENTVIAPKLSELETAKAAAEAQLTA
FT                   GGLTDEEEAELESKITTYANSIATLNNYIDLAAAFDFNSDGTVTAGAAQTDENKETTNE
FT                   LYISSNSRVTSQAALLNKAYFEETIASITTVTELLADTRLYNYIRTAFDLDEVTIVSAT
FT                   IKNILTSDPDDPDSYVNTIGGGDANYLALANAFNFQEDGTLAVGDSAQTAAQTTLTSNR
FT                   YMTRYNDKDDEADEKAVSAYKTAVASMTSVDDFIGSASIYDFALKAVGLDPDTASTRTI
FT                   KRVLTSDLTDPKSYVYSLKDERYVTLAKLFNFTTEGEIGPPALAQSETQIQETAKNHIV
FT                   IKSRFGSEDDKTKAQEESEYYTAGVAKLSSLDEFLADDRLVTIALEANGIDPEGVTADV
FT                   LRQIFNSDLDDPESVINEQENSAAYVSLVTSFNFDSEGNVLREDRDSIVTRQGLYETLD
FT                   QYLRQTLEEQAGESNEGVRLALYFERKAGSLVDAYDLLADDALAEVFRTIFSLPDEFST
FT                   MDIDQQAKIVEKNLDLEKLSDPAELKKLLARFAVLYDLENNTEVDPAVSVLTSTGSSVG
FT                   ISADTLYTLSQLRMGG"
FT   gene            complement(535366..536796)
FT                   /locus_tag="NGR_c04820"
FT   CDS_pept        complement(535366..536796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04820"
FT                   /product="FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04820"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24278"
FT                   /db_xref="GOA:C3MHF0"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHF0"
FT                   /protein_id="ACP24278.1"
FT                   /translation="MTAIPSPELIASFADIVGPGHALTAPAETAPYLVESRGLYHGTTP
FT                   LVLKPGSVDEVSRILQLASRTQTAIVPQGGNTGHVAGQIPREGKADVALSLERLNRIRD
FT                   IDPVGNVIVADAGCILADIQKAADDVDRLFPLSLGSEGSARIGGNLSTNAGGTAVLAYG
FT                   NTRQLCLGLEVVLPTGEVWDGLRRLKKDNTGYDLRDLFIGAEGTLGVITGAVLKLFPKP
FT                   RGHQVAFAGLASVDAALSLFDRASSLCGPALTGFELMPRLGIEFTTRHIPGVRDPMETS
FT                   HPWYALIDISSSDSAESAERMVQGLLEAGIDDGLVENAVIAQSEAQRKALWHLRESMSP
FT                   AQKPEGGSIKHDVSVPVSSIPAFMADADAAVMTAIPDARICAFGHMGDGNIHYNISQPI
FT                   GADSQAFLARWREVNAIVHAIVLKYNGSISAEHGIGQLKRDELAAIRSPIEIELMRRIK
FT                   HAFDPAGIMNPDKVLRQD"
FT   gene            complement(536824..537798)
FT                   /locus_tag="NGR_c04830"
FT   CDS_pept        complement(536824..537798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04830"
FT                   /product="Sua5 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04830"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24279"
FT                   /db_xref="GOA:C3MHF1"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHF1"
FT                   /protein_id="ACP24279.1"
FT                   /translation="MAEIIDTRIEPDRAIEKACAALSEGEPVAIPTETVYGLAADATNA
FT                   DAISRIYEMKGRPRFNPLICHVSDMAMAEAHVVFDPLSRRLAEAFWPGPLTLILPERRE
FT                   STVHALASAGLETLGIRMPEGFSRRVISHFGRPLAAPSANTSGKISPTSAAHVEADLGA
FT                   KLGLILDAGPAEIGLESTIIKVEAGRLRLLRPGGLDAAEIEALTGLTVGRPEAAGATIE
FT                   APGMLASHYAPGAAVRLNAKDVRKGEALIRFGGKALPGESAAAIVLDLSPSGNLREAAA
FT                   NLFDYMKRADASGVSSIAFGPVPSEGLGEAIVDRLERAAAPRI"
FT   gene            complement(537867..538466)
FT                   /locus_tag="NGR_c04840"
FT   CDS_pept        complement(537867..538466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04840"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24280"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHF2"
FT                   /protein_id="ACP24280.1"
FT                   /translation="MAKLRYYDASGGTQAPTPKTAGHTEFLRTGRIDRRRPWLPEQRRY
FT                   MTHEEVAEKTGRKLQAAGETTHKRINGFHASIQFPKLIFHRTLADSPHLGYCHVTAART
FT                   NLNHSREIAWAFYFANFFSDLGDETHFFERIQPSYSRMYFAVAIEPNAEGGQMAINRNV
FT                   RGNGLIFRTQDPKVALKNVLMLGARDEALRRIIRRL"
FT   gene            538526..538774
FT                   /locus_tag="NGR_c04850"
FT   CDS_pept        538526..538774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04850"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24281"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHF3"
FT                   /protein_id="ACP24281.1"
FT                   /translation="MVNRLFRRFAGCLALLCVAKRPAVFAAETALLRKFSVWKRSTYRI
FT                   VYSIKYYRCLDVIARKSLSSFQNGMSHIGSCRAELPA"
FT   gene            538986..540236
FT                   /locus_tag="NGR_c04860"
FT   CDS_pept        538986..540236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04860"
FT                   /product="putative dioxygenase, alpha-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04860"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24282"
FT                   /db_xref="GOA:C3MHF4"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHF4"
FT                   /protein_id="ACP24282.1"
FT                   /translation="MGMDIQNDMLRKLKTRRDGYSLDRAFYIDPDYYRQDLEHIWYKDW
FT                   LFVGHDCEIPRPGNYFTLQVGDYPVVIVRDRQGAVRALHNSCRHRGSRVCTQHKGSSAK
FT                   LVCPYHQWTYELDGRLLFARQMPEGFDPSEHSLKPVNCETVGGYIFVSLADEPMDFQPF
FT                   RETVAGYLAPHRLGETKVAYESKIVEKGNWKLVWENNRECYHCAANHPELCRTYPEAPT
FT                   VTGVQGAMDDPEIGAHWERCEAAGLPSAFKIGPTGQFRMTRMPLINGAESYTMSGERAV
FT                   RQQLSAGVDANRIGTLLLFHYPTTWNHILGDHAITFRVLPLGPELTEVTTKWLVNKDAV
FT                   EGVDYTLEDLTHVWTETNDQDRQIVEENAFGIRSPAYQPGPYSAEHEGGVMQFVDWYSR
FT                   FMLDRLQGSAAPLSRVA"
FT   gene            539981..541333
FT                   /locus_tag="NGR_c04870"
FT   CDS_pept        539981..541333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04870"
FT                   /product="putative dioxygenase reductase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04870"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24283"
FT                   /db_xref="GOA:C3MHF5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHF5"
FT                   /protein_id="ACP24283.1"
FT                   /translation="MACQQGCGRGCRLYARGSDACLDRDQRPGPPDRRGKRIRHPFAGL
FT                   SAGALFGGTRGGRHAVRRLVFALHAGSPAGQRRSSVAGGMTMEMARSFHHFDELHPWID
FT                   RQHLLECTSVVAETADVMTFTFRSDRPAWFRYLPGQFVTLELPTGEEPVMRTYTLSSTP
FT                   SRPLSVAVTVKAQSNSIGTRWMFDNLKPGMVLKALGPLGDFSFVRHPGEKYLFISAGSG
FT                   ITPMMSMTRWMADCAPATDVTFVSCARQPEDLLFKSELEILARQMPHLNLGFLVEGHEA
FT                   RHGWHGLRGRIDATKLPLLAPDVLERTVFCCGPEPFMRGVRDMLKGAGFDMARYHQESF
FT                   QPAAAPAAEELAIRAGPATGAGAEAARVTFTMSGKDVSAVPGQTILQTARANGVRIGAA
FT                   CEGGICGTCRVLKIAGDVAMNHNGGILDDEIDEGYILACCSRPLGDVQIEA"
FT   gene            complement(541373..542398)
FT                   /locus_tag="NGR_c04880"
FT   CDS_pept        complement(541373..542398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04880"
FT                   /product="glycoside hydrolase family 25 protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04880"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24284"
FT                   /db_xref="GOA:C3MHF6"
FT                   /db_xref="InterPro:IPR002053"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHF6"
FT                   /protein_id="ACP24284.1"
FT                   /translation="MRLAALVGLTFAAANARAADVEPWKARQNAIIVDAYELNSIDWDA
FT                   MLKDKRIAGFIAKASDGLPESFTCTGDHGGDTVAHCKTMWRKYAVSRELYQTRRMIARF
FT                   QGLLWGAYHLARPGNPVDQANHFLDYAEPRDDELMVLDIEGIDPEDYMSLEDAAIFAGH
FT                   IKARTGRYPILYTNHITAKYIAANRHQHRLLSRLPLWYARYKPDIRDVFPMGNWDGYAL
FT                   WQFSSSHNCGKKRCPYRVPGTLNDIDVNVAAMSVSELKKVWAQGALLPEKPPIVTVVAS
FT                   AKLGSAPAASAAVSIPLTQPLLISRAEADSGSGTGVDGTVTGAISVKAAEVHLPNQPER
FT                   R"
FT   gene            complement(542597..543586)
FT                   /locus_tag="NGR_c04890"
FT   CDS_pept        complement(542597..543586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04890"
FT                   /product="putative cationic transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04890"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24285"
FT                   /db_xref="GOA:C3MHF7"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHF7"
FT                   /protein_id="ACP24285.1"
FT                   /translation="MNLISPEIPGLVWAYRFLPGESRCVPLATDSPVDSLQTGDGWIWL
FT                   HLALSDARTPALIERIGNLPPAAIATLTSHDTQAAITVAEDVVYGTLVDFERTFDTMTK
FT                   TIGWLHFAVSDRMIITTRLHPLRSIDRVKAAVEKSAKCGRPIDLFEMLVVEFQRTLITL
FT                   VLELTEELNVIEDRVYGEAGHRQQPGLAPLRRTVVRLHRHLRTILALLRRAGASDEDEV
FT                   PPGFIDAAERLSDRLETVDRDVFALQERARLLHEEIDSKISSETNRHLYILSLMTAFLL
FT                   PPTLVTGFFGMNTGALPFADGSGTFFAGLIIAASMGLAWLILKRVGIL"
FT   gene            543873..545654
FT                   /locus_tag="NGR_c04900"
FT   CDS_pept        543873..545654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04900"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04900"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24286"
FT                   /db_xref="GOA:C3MHF8"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHF8"
FT                   /protein_id="ACP24286.1"
FT                   /translation="MYKAPVDEIAFTLKHVAGMAEAVRAGTFGELGEDLVEAILSEAGR
FT                   FATEEVAPLGEVGDRQGSRLVDGAVKTPEGWRDLYHDWIQGGWNGLTAPEAFGGQDLPH
FT                   MLHVAAMEMWNSGSMAFALGPTLTMGAIEAVEKHGSDALKATFLSKMVSGEWMGTMNLT
FT                   EPHAGSDLGVLKTRAERRADGTYRIFGQKIFITWGEHDFTDNIVHLVLARLPDAPAGTK
FT                   GISLFLVPKFLVNADGSLGARNDLFCHSLEHKLGIHGSPTCTMIYGDGRFGDEKGAIGY
FT                   LVGEENRGLACMFTMMNNARLAVGMQGVAIAEAATQKAIAYARERTQGRAPGWTGQGMS
FT                   PIIEHPDIARTLLTMKALTQGARAIAYACAHAVDMAHASHSEKAHQWQERSSLLTPIAK
FT                   SFATDAGVDVASMGIQVHGGMGFIEETGAARYLRDARIAPIYEGTNGIQAIDLVTRKLR
FT                   LSEGAQVRGFIGELREVAHAVAASNRQGFGETAARLEASIADLADATEWLLAALAEGRT
FT                   AEALAGATAYQRLFGLALTGVYLAKGGLAEAGDGKQEARIALCRFAAENLLAETAALRD
FT                   RVVAGADSLAAARAILD"
FT   gene            545721..546473
FT                   /locus_tag="NGR_c04910"
FT   CDS_pept        545721..546473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04910"
FT                   /product="enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04910"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24287"
FT                   /db_xref="GOA:C3MHF9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHF9"
FT                   /protein_id="ACP24287.1"
FT                   /translation="MTDHVLVERPEAYPGVQVIRFNRPEKKNAFTREMYAKMTNALTVA
FT                   VSDPAIRATAFLGTDGCFSAGNDMNDFLAFAMGGSMGGEVLDFLRALASATKPVVSGVD
FT                   GLAIGIGTTIHLHCDLTVASARSVFKTPFVDLALVPEAASSLLAPRIMGHQRAFALLAA
FT                   GEPLEAAEALQAGLIWKIVGENAVEEETLALAARLARKPPEALRIARDLIRGDRNDVLA
FT                   RIDKEAEHFAAQLKSTEARAAFEAFMRR"
FT   gene            546793..548892
FT                   /locus_tag="NGR_c04920"
FT   CDS_pept        546793..548892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04920"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04920"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24288"
FT                   /db_xref="GOA:C3MHG0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHG0"
FT                   /protein_id="ACP24288.1"
FT                   /translation="MSKRSNLMTRILVAASCVVVGAFAGFSVYIDTLQRGTTTKAVEEN
FT                   IASSGKQAAESVANWLNGRVTLTAMAADAAARASDEAAILAALKNDVLTGEFMSTYVGN
FT                   GSGKFITWPEMKLPEGYDPRQRPWYQQAVKTDARVLTEPYIDASSGDLIISAAMPVKRE
FT                   GKLYGVAASDFSLKTLVSMITDIDVGGEGFAFLASKDGQILVHPDAKLVTKTLSDAFPV
FT                   DTPSIGSGIMHTELGGKPMLVSFVPVQGLPSVEWYIGFALDADAAYSAISQFRIAATVA
FT                   TLLAVGAMIVFLATLLSRLVIRPVTQMTGAMEKLAAGNLDVAIPGEERRDQIGSMAAAV
FT                   AVFRANALERARLEDEAHANRSLSERERLEREAQKARDVAEVQHAVEALATGLGRLADG
FT                   DLAYRIENPFADRLDRLRADFNNSVAKLHDALRAVGANARAIDAGASEIRSAADDLARR
FT                   TEQQAASVEETAAALEEITTTVKDSAHRAEEVGGLVARTRAGAEKSGEVVQNAVEAMQA
FT                   IEKSSGEISNIIGVIDDIAFQTNLLALNAGVEAARAGEAGKGFAVVAQEVRELAQRSAN
FT                   AAKEIKALITTSGDQVRSGVALVGETGRALQAIVAEVQEINKHVSAIVTATREQSTGLQ
FT                   EINTAVNTMDQGTQQNAAMVEEQTAASHGLAQEAAALNALLAQFKLGDGQASASFVAGQ
FT                   RRYAA"
FT   gene            complement(548938..550185)
FT                   /locus_tag="NGR_c04930"
FT   CDS_pept        complement(548938..550185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04930"
FT                   /product="RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04930"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24289"
FT                   /db_xref="GOA:C3MHG1"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHG1"
FT                   /protein_id="ACP24289.1"
FT                   /translation="MSTEIVTVNRLGAQGDGIAQTEAGPVYAPFTLPGETVALAVNKAH
FT                   GTLISLKEASPDRIEPTCRHFGPDGVNGTCGGCTLQHASDPLYHAFKRNLVIDALKSKG
FT                   LKPEVAPLIIARPGERRRAVFTARRTEKELLLGFNQAQSHHIVAVGECPITSPGIVSRL
FT                   PTIRKIAAAMASGAEPFRITVLETDSGLDLAFEDIKLSDRQRRSTVEAVLGERGIARVS
FT                   LNGEIIIEPVKPLIDFDGVSVSPPPGAFTQATRPAEEAMAKLVLGHIGKAKRVADLFAG
FT                   IGTFALRIARTARVHAVEGEDKALKALDFAARNTQGLKPVTVEKRDLFRRPMMAQELKV
FT                   FDAVVFDPPRAGAEAQCHELARSGVKKIAAVSCNPVTLARDLSILVAAGYRIRSVTPID
FT                   QFLWSAHVEAVATLEK"
FT   gene            complement(550182..550937)
FT                   /locus_tag="NGR_c04940"
FT   CDS_pept        complement(550182..550937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04940"
FT                   /product="hemolysin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04940"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24290"
FT                   /db_xref="GOA:C3MHG2"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHG2"
FT                   /protein_id="ACP24290.1"
FT                   /translation="MSDNKHSTIRLDQLLLNKGLVASRARARDAIQRGTVMVDGRTVTK
FT                   PATAFAANATITIDDPAQDYVSRAALKLVGALDHFGFDPAGQICLDIGASTGGFTEVLL
FT                   KRGAAHVVAVDVGHGQMHPRIAEDPGVTNIEGLNARAMTADDIGNRTITFIVSDVSFIS
FT                   LKLALPPALSLAGPGARCILLVKPQFEAGRDAISKAGLLKDPESAPTVAAELERWLVED
FT                   MGWRSLGLVPSPIAGGDGNKEFLLAGLKP"
FT   gene            complement(551187..553124)
FT                   /locus_tag="NGR_c04950"
FT   CDS_pept        complement(551187..553124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04950"
FT                   /product="1-deoxy-D-xylulose 5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="1-deoxyxylulose-5-phosphate synthase; DXP synthase;
FT                   DXPS"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04950"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24291"
FT                   /db_xref="GOA:C3MHG3"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHG3"
FT                   /protein_id="ACP24291.1"
FT                   /translation="MTQLPTNPMPATPLLDKVNVPDDLKKIDDRDLPQLASELRSEMID
FT                   AVSRTGGHLGAGLGVVELTIAIHKVFDTPHDRLIFDVGHQCYPHKILTGRRDRIRTLRQ
FT                   EGGLSGFTRRAESEYDPFGAAHSSTSISAGLGMAVAADLDGKSRNVIAVIGDGALSAGM
FT                   AYEALNNAGALDARLIVILNDNDMSIAPPTGAMSAYLARLASGRTYMGIREVGKKLTAY
FT                   LGKTVDRAITRAVEHARGYVTGGTLFEEMGFYHIGPIDGHSFDHLLPVLRNVRDNRRGP
FT                   VLIHVVTQKGKGYPPAEAAADKYHGVNKFDVITGAQAKAKPNAPAYTSVFADALTQEAS
FT                   LDDKIVAITAAMPHGTGLDRFAAVHPSRCFDVGIAEQHAVTFAAGLAAEGYKPFAALYS
FT                   TFLQRAYDQVVHDVAIQGLPVRFPIDRAGFVGADGPTHAGSFDTTYLASLPGFVVMAAA
FT                   DEAELKHMVRTAAAYDDGPISFRYPRGEGVGVELPERGEILEIGKGRIIKQGTKVALLS
FT                   FGTRLADCLLAAEDLDAAGLSTTVADARFAKPLDHELIRQLARHHEVLITIEEGAIGGF
FT                   ASHVLHFLAEEGLLDGGLKVRPMVLPDIWMEQAKPESMYAAAGLDRVGIVSTVFKALGQ
FT                   KHSVGLGAAG"
FT   gene            complement(553261..554184)
FT                   /locus_tag="NGR_c04960"
FT   CDS_pept        complement(553261..554184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04960"
FT                   /product="pirin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04960"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24292"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHG4"
FT                   /protein_id="ACP24292.1"
FT                   /translation="MSFFPGPDPLAGDKPACDAIEHLIIPRTSDIGNLEVRRALPTARR
FT                   RLVGPFIFFDRMGPALLRAGQAIDVRPHPHIGLSTVTYLFDGEIKHRDSLGTEMVIRPG
FT                   DVNLMTAGRGIVHSERSPESQRGHERSLSGLQTWLALPDDKEEVDPVFSHTEERVLPHL
FT                   ADDGVRARVVIGRFEGAASPVSTFTDTIYVDLAIEAGRSAPFAAQWEERAIYILSGEAI
FT                   IAGDHFADNQLLVFRPGDEITITAGPAGCHVMLFGGAALGSPRHIWWNFVSSSKERIDK
FT                   AKEEWRSGRFDIVPGDEEEFIPLPAS"
FT   gene            complement(554367..555746)
FT                   /locus_tag="NGR_c04970"
FT   CDS_pept        complement(554367..555746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04970"
FT                   /product="putative transposase for insertion sequence
FT                   NGRIS-13j"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04970"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24293"
FT                   /db_xref="GOA:C3MHG5"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHG5"
FT                   /protein_id="ACP24293.1"
FT                   /translation="MPRRIGRDRCPVGSPRRSCIRFRAPVQGSAKIAVARRLGRGEGMT
FT                   DQKQFYAGVDWASESHHVFLTDGDGRKIGERVFRHGGEGLAELAAWLTATSGATEAGQI
FT                   QVAIEVPHGPVVETLIERGCQVHAINPKQMDRFRDRFTLAGAKDDSRDAEVMASALRTD
FT                   RRCFRLLAAADPVVIELREWSRMAEDLGAERNRLTNRMREQLWRYFPALLELENDLGAE
FT                   WLLDLWEAVPTPAKAARIRAATIAKLLKRNRIRRVDATHVLAVLRTPPVKVAAGTTEAA
FT                   SAHIATLIARIRLVNRQLKQAHQRLDTLTARLVPTEATEPGQRKQHDVEILASLPGVGR
FT                   IVLATLLAEAFDALQRRDHAALRSLTGVAPVTKRSGKSCIVIRRQACHDRLANAMYHWA
FT                   RVAIQHDSRSRLKYAALRSQGHSHGRALRSVADRFVNVACAMLKTGTTFNPSLAEQKLS
FT                   C"
FT   gene            complement(556026..556280)
FT                   /gene="xseB"
FT                   /locus_tag="NGR_c04980"
FT   CDS_pept        complement(556026..556280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="NGR_c04980"
FT                   /product="exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04980"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24294"
FT                   /db_xref="GOA:C3MHG6"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHG6"
FT                   /protein_id="ACP24294.1"
FT                   /translation="MNNNNTQPDVSALSFEQAVEELERIVSALERGDVALDKSIEIYER
FT                   GEALKKHCETLLKAAEDRIEKIRLDRNGKPQAVEPLDAE"
FT   gene            complement(556283..557212)
FT                   /locus_tag="NGR_c04990"
FT   CDS_pept        complement(556283..557212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c04990"
FT                   /product="histone deacetylase superfamily"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04990"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24295"
FT                   /db_xref="GOA:C3MHG7"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHG7"
FT                   /protein_id="ACP24295.1"
FT                   /translation="MTTHLYENALFQEHKVPEGHPERPDRLRALNLALEHPNFAPLKRI
FT                   EASKGSEDLVLLAHTEEHLRSIARAIPEDDINQIEADTYASPSSFEAALTGIGGAVAAV
FT                   DAVFAGEADNAFVAARPPGHHAEKNRAMGFCFFNTIAIAARHAQKAHGVERVAIVDWDV
FT                   HHGNGTQDIFWNDPSVLFCSTHQMPLYPGTGAKEETGARNNIVNAPLSPNSGSEHFREA
FT                   FRSRVLAALDNFRPDFVLISAGFDAHYRDPLAQINLVAEDFDWATGRLMEAAGKSAGNR
FT                   VVSMLEGGYDLQGLAESAALHISRLMRG"
FT   gene            complement(557276..558244)
FT                   /locus_tag="NGR_c05000"
FT   CDS_pept        complement(557276..558244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05000"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05000"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24296"
FT                   /db_xref="GOA:C3MHG8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHG8"
FT                   /protein_id="ACP24296.1"
FT                   /translation="MRSTLVRQFGDPEQVIELVDAARIEPGAGEVEVEISLAAINPSDL
FT                   IPVTGAYRARTELPFVPGFEGVGVVRRVGGGVHHLKPGDRVMPIGASGLWQQFVVRPAE
FT                   WCFAVPDDVSDVQAAMSYVNPLTALRLVEALRGHFGSLEHRSVAVTAAGSAIGAMLMKL
FT                   LAMEGVAPTAILRSEKSRHRLGQAYPIVVTDGSNLPGGTRFDAVLDAVGGQLAAELISR
FT                   SIHPGGTFIQYGALSGIPVPQAAIAARADVRFAFLWLRTWVHSAGREALEAGFARSFAG
FT                   LRDGLFASPVAATYPLSRLGEALAHQADPLRNGKILLDPCC"
FT   gene            558259..558660
FT                   /locus_tag="NGR_c05010"
FT   CDS_pept        558259..558660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05010"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24297"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHG9"
FT                   /protein_id="ACP24297.1"
FT                   /translation="MDGTERENVTEIRIPFRDIDMHGHMHNAAYYAHAEAALASLWRHR
FT                   PPVNNEPAYLVRRSACLFHRGLRFDEPARFTVSVAKIGGSSVSFAVRVEAGAHLAAEVE
FT                   IVWVAVDPARHQPVALPAATRDWLSAYIA"
FT   gene            complement(558648..559847)
FT                   /locus_tag="NGR_c05020"
FT   CDS_pept        complement(558648..559847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05020"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05020"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24298"
FT                   /db_xref="GOA:C3MHH0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHH0"
FT                   /protein_id="ACP24298.1"
FT                   /translation="MPLNASSDPTRTPVVIQALRTPIGRVNGSLATIEPESLAALLIDR
FT                   IVTDTGIDRNDIDDVLLGNAANSAGNLARLAALEAGLPVSIPGVTVDRQCGSGLEAIVL
FT                   AARQIQAGAGRYFLAGGTESASRAHIRLRPPLARGEELQPVKRARMAPDLIGDPDMGVA
FT                   AENVAAVCGISRERQDQFALESHRRAVAAETAGRFQREIVPVETPIGPVAIDECPRPNA
FT                   SAETLARLKPVFVKDGTVTAGNACPINDGAAVVLVTSLAQARRRGVPFALEFVDAATAG
FT                   VDPNLLGLGPVPAMAKLRARNPALDVDKVDFIEFNEAFASQVLGSLDPLGISPERVNRD
FT                   GGAIALGHPYGASGAILVVRLFSQMLAAARDSEGLAMMGVGGGMGVVAHFRSLRLDQAI
FT                   "
FT   gene            complement(559825..561321)
FT                   /locus_tag="NGR_c05030"
FT   CDS_pept        complement(559825..561321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05030"
FT                   /product="putative long-chain-fatty-acid--CoA ligase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05030"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24299"
FT                   /db_xref="GOA:C3MHH1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHH1"
FT                   /protein_id="ACP24299.1"
FT                   /translation="MPLARAILRHEGERLHAPAFRIEGRVFTFAELAAAAGRILHAIEQ
FT                   AALQTTEQSVLAGRVRLIALETGNHPLFAAAFIAATSGGNCAALIDPHLPESRRQRMKE
FT                   KLRPEIVIRADGDRLHLDVPSVGETHALETFDGSSPISIGEDAEPFLVVFTSGTTGEPK
FT                   AIIRDRGSWRLSLETGQHFFGIGPEATTYAPGPLAHGLALYALVECLAAGAEFIGARHF
FT                   EPRQALDVISDTRAKRLVLVPTMLRRLCEQTKSAAVTSVEKITVAGAKLTPADRSAAAR
FT                   AFPAAEVIEYYGASELGFITVAGADDDHSPTAVGKPFPGVRLAILDDRGNSLPSGETGA
FT                   IFVDSALISYGYIASNDGIGFHREGRLATVGDLGFLDRDGTLHLIGRAGGMVLSGGNNI
FT                   YPSEVEAAIMAAAGVRSVLVFGIDHPDLGSELVAVIQPNHDRFEREELERHLADALPRY
FT                   KHPRKVWLCREMPMTVSGKIAVGKLQQWIAEENGALERLF"
FT   gene            complement(561326..561889)
FT                   /gene="bioY"
FT                   /locus_tag="NGR_c05040"
FT   CDS_pept        complement(561326..561889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioY"
FT                   /locus_tag="NGR_c05040"
FT                   /product="possible biotin synthesis BioY protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05040"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24300"
FT                   /db_xref="GOA:C3MHH2"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHH2"
FT                   /protein_id="ACP24300.1"
FT                   /translation="MNTRDLVLIALFAAIVVVLGLIPPITLGFIPVPITAQSMGVMLAG
FT                   CIIGAKRGALAFLLFVLLVAIGLPVLSGGRGGLAVFAGPSGGFILGWAVAAFVTGLIAE
FT                   RFVHQGNSEARQFVGFFLASVIGGIVVLYAIGVPWLSAVTGTPLTAAATGALVFIPGDL
FT                   LKAAIATLAARAVYAGYPLLPARA"
FT   gene            complement(561922..562527)
FT                   /gene="bioN"
FT                   /locus_tag="NGR_c05050"
FT   CDS_pept        complement(561922..562527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioN"
FT                   /locus_tag="NGR_c05050"
FT                   /product="putative biotin transporter, permease protein
FT                   BioN"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05050"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24301"
FT                   /db_xref="GOA:C3MHH3"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHH3"
FT                   /protein_id="ACP24301.1"
FT                   /translation="MLTSLYVEGQSWFHRVPVRLKLIALLVLSVGLFTTNAPLLLLPAF
FT                   LLCGALYLSLGMTARQAFSRVGFVLFTILILAAVNLFLVPFPDVAALVLRLTALVLFAA
FT                   AVTATTTIGAFMDETTILLKPAERLGLLRAADVSLALGLVLRFVPDIFARYQAISEAHR
FT                   ARGLPIRPLTIIGPLIILTLKDADTIAAAIDARGFRRQ"
FT   gene            complement(562521..563201)
FT                   /gene="bioM"
FT                   /locus_tag="NGR_c05060"
FT   CDS_pept        complement(562521..563201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioM"
FT                   /locus_tag="NGR_c05060"
FT                   /product="putative biotin transporter, ATP binding protein
FT                   BioM"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05060"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24302"
FT                   /db_xref="GOA:C3MHH4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHH4"
FT                   /protein_id="ACP24302.1"
FT                   /translation="MDIRLTDCSVRFGERVALHPLTLALDERRIGIIGLNGSGKTTFAR
FT                   LINGLVKPTTGRVTVNGLDTVKDDRAVLAEAGFIFQNPQHQLIMPIVSDDIAFGLKNRG
FT                   LPAHEISSRTEAVLARFAVSHLARRRVHELSGGETQLIAMASVVVTGPKILILDEPTNQ
FT                   LDLRNRRMVAATIDALDEDTIVITHDLGLVEAVERLLLFHEGRLVADGSPGETIRRYHE
FT                   VAGC"
FT   gene            563333..564532
FT                   /locus_tag="NGR_c05070"
FT   CDS_pept        563333..564532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05070"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24303"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHH5"
FT                   /protein_id="ACP24303.1"
FT                   /translation="MTIRLSNRDARRIFLAKQGLSAAPHRALGKDGLLRLIHDIGFVQV
FT                   DSISTVARAHHQILFSRNQTYRREHLSELLEEDGDLFEHWTHDASIIPSAFFVYWKHRF
FT                   KWESETLRERWRRWRGEGFDASCDETYERIASGGAVMARELKEDHHESGGWWNWHPSKT
FT                   ALEVLWRQGRLAIARRVNFQKVYDLTERVIPAHHYEGDVSHPEFIDWACRSALGRLGFA
FT                   THGEIAAFWDLASPEEAKAWVAEHRDELCEILVEPANGGKPRPSYAFTGFPDNLGDVPD
FT                   PPARIRVLSPFDPLLRDRNRTERLFGFFYRIEVFVPEAKREYGYYVFPLLEGDRLIGRI
FT                   DMKADRKRGSLEVRRLWLEEGIKPSSGRIDKVMAELDRIARFAGVGGVNLLEGWNAGLA
FT                   "
FT   gene            564606..566021
FT                   /locus_tag="NGR_c05080"
FT   CDS_pept        564606..566021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05080"
FT                   /product="Zn-dependent protease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05080"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24304"
FT                   /db_xref="GOA:C3MHH6"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHH6"
FT                   /protein_id="ACP24304.1"
FT                   /translation="MDTNLISLFDADEATVRKVLSETLAGADDGELFLEHAQAEVLSFD
FT                   NGRLKGGSFNTDQGFGLRAVAGEAVGYAHAGEVSLAALKRAADAVGQVTRGYSGSYAAA
FT                   PQRTNKKLYGDENPIGEPRFETKVTLLQEIDAYLRAKEPKVRQVTATVATSWQVVDILR
FT                   ADGHRVHDVRPMTRINISVVVGEGDRQESGTFGIGGRRGFGDFITEENWKRGADEALRQ
FT                   ALVNLEAVDAPAGTMDVVLASGWPGVMLHEAVGHGLEGDFNRKKTSAFAGLLGEQVAAK
FT                   GVTVVDDGTIEARRGSISIDDEGTPSGYNVLIEDGKLVGYMQDRQNARLMGMQPTGNGR
FT                   RQGYAHVPMPRMTNTYMLAGDRTPEEIIASVKKGIYAVSFGGGQVDITSGKFVFGCTEA
FT                   YLIEDGKVGAPAKGAMLIGNGPDAMRRVTMVGNDMKLDTGIGNCGKGGQWVPVGVGQPH
FT                   LRMDQITVGGTQA"
FT   gene            566031..566534
FT                   /locus_tag="NGR_c05090"
FT   CDS_pept        566031..566534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05090"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05090"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24305"
FT                   /db_xref="GOA:C3MHH7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHH7"
FT                   /protein_id="ACP24305.1"
FT                   /translation="MISQAGDSLEIRRFSTSDEQGVIDVILPIQREEFGIAITAEDQQD
FT                   LRAIPEFYQSGNGDFWIAAAGERIVGTIALKDIGGAEAALRKMFVASAFRGREHAVAAR
FT                   LLDALLAHAERRNIEAIYLGTTEKFLAAHRFYEKNGFVEIAMQDLPASFPVMGVDTKFY
FT                   VRRI"
FT   gene            566880..567038
FT                   /locus_tag="NGR_c05100"
FT   CDS_pept        566880..567038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05100"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05100"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24306"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHH8"
FT                   /protein_id="ACP24306.1"
FT                   /translation="MIVTDELDALIERLRRADTRFRGDMSDGGAGRAILLEDPSGNVIE
FT                   LFEFKKD"
FT   gene            567218..568600
FT                   /locus_tag="NGR_c05110"
FT   CDS_pept        567218..568600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05110"
FT                   /product="putative transposase for insertion sequence
FT                   NGRIS-20f"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05110"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24307"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C3M906"
FT                   /protein_id="ACP24307.1"
FT                   /translation="MQTHCIAEQLEFEGFDGHKVVAGFDGGAITSDAGALLLRHVDGVI
FT                   GLFDRVAACFVDDRDPTCTVHSVRTLVGQRVAAIALGYEDVDDHDRLRHDPVLALLSER
FT                   LTPKRQDCAVLAGKSTLNRLEHGRLGQPTRYHKIAYDRQALEALFIELFLDAHDSPPEE
FT                   IVLDLDATDDPLHGHQEGRFFHGYYNCYCYLPLYIFCGRHLLSAKLRRSNIDASAGSVA
FT                   EIDRIIGQIRQSWPNVRIILRADSGFARDELMDWCETNKVDYVFGLARNPRLERQIAPA
FT                   MEEASLLSQASAQATRVFRDFLWSTKDSWTRRRRVVGKAEWTLLGANPRFIVTSLKPER
FT                   WAAQTLYEDLYCARGDMENRIKECQLDLYADRTSAHTMHANQLRLWFASLAYVLICALR
FT                   RLGLAHTRLAEATCGTIRLKLLKIGAQVRVSVRRIKIAMASACPYADEFALAHARIRAA
FT                   AR"
FT   gene            complement(568769..570022)
FT                   /locus_tag="NGR_c05120"
FT   CDS_pept        complement(568769..570022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05120"
FT                   /product="putative D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05120"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24308"
FT                   /db_xref="GOA:C3MHI0"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHI0"
FT                   /protein_id="ACP24308.1"
FT                   /translation="MRNLQIALAAIVAFVAATASAFAGSASFVIDARSGRVLSAENADE
FT                   LNYPASLTKMMTLYLTFEALHRGEINWQTPVPMSKEAARKPPTKLGLKPGSAITVEEAV
FT                   YGMIIHSANDAAAAMAEKLGGSEAAFAQMMTAKARRLGMTRTVFVNASGLPASQQVTTA
FT                   RDMAKLGMALLRDFPREYRLFSAQSFNFRGRVVRGHNKLMYRYDGMDGIKTGYTNASGF
FT                   NLVSAVRDGNRRVIGVVLGGRTAKSRDNKMAALLDQHLGRPSQQGTGTAVAATKPLDTV
FT                   EVATLPGVSLYAEPKSGQKNASAAIMAASPTRVVPADRPTDLEEVASTQPKVEAYWQIQ
FT                   ISTSPSAEAARKILVEAQSAGGAALLGASPHTDVDGSGSAKRYRARFIGFASREAATSA
FT                   CNILKKRAYDCQLLPGRS"
FT   gene            570265..571377
FT                   /locus_tag="NGR_c05130"
FT   CDS_pept        570265..571377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05130"
FT                   /product="putative polysaccharide deacetylase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05130"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24309"
FT                   /db_xref="GOA:C3MHI1"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHI1"
FT                   /protein_id="ACP24309.1"
FT                   /translation="MRHSLATMVRNHLRRAAIAGGLEAANALARLGLMAESRGRGAIFT
FT                   LHHVRPKGHRDFDPNGHLEITPAFLEKTILTLKRAGYRFAALDELPEWLAATDERPVAC
FT                   FTLDDGYRNNLEWAQPVFERHGVPFTVFVTAGYVDRTHTLWWETLADLLSARHEFRFDF
FT                   GDGAVLVSSGSSVQKQAAFDRIAAYIHGADEARAVAVLNCAALEHGIDPIAITEHLTLD
FT                   ESGLRALIANPLASLGAHTISHRALARLNDDEARREITSSAARVEAITGRRPLTIAYPY
FT                   GFRPTVSARDHRLAADLGFTVAVTTEPGTLSSGVNRHAVPRISLNGHFQSERYVSALAS
FT                   GIPFRLLHDSLNRNRFKDKIMQQFEALQRP"
FT   gene            complement(571433..572053)
FT                   /gene="pdxH"
FT                   /locus_tag="NGR_c05140"
FT   CDS_pept        complement(571433..572053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxH"
FT                   /locus_tag="NGR_c05140"
FT                   /product="pyridoxamine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05140"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24310"
FT                   /db_xref="GOA:C3MHI2"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MHI2"
FT                   /protein_id="ACP24310.1"
FT                   /translation="MTANELTTGDFTDADEPFSLFGTWLKDAEKNEVNDPNAVALATVD
FT                   PDGLPNVRMVLLKGFDEHGFVFYTNFESQKGQELLSTRKAAMCFHWKSLRRQVRLRGPV
FT                   EIVTAEEADEYFRSRPRGSRIGAWASKQSRPLESRFALEKAVAEFTARHAIGEIPRPEY
FT                   WSGFRIRPTSIEFWHDRPFRLHDRVEFRRPVPEGGWEKVRMYP"
FT   gene            572195..572647
FT                   /locus_tag="NGR_c05150"
FT   CDS_pept        572195..572647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05150"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24311"
FT                   /db_xref="InterPro:IPR032635"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHI3"
FT                   /protein_id="ACP24311.1"
FT                   /translation="MQDIAKWIDGKKGFSFALLRSAALCLTVVALPGCMGGGLDLFGSS
FT                   SVDRSVATGTVPVAKTSDGLSDAVTVRNAVSSAEITEGGSAIPWANATSGSAGVISSIE
FT                   EDHASGVLCRRFTTTRHSFEGIAKFDGRTCRLDNGEWYLTSFGPQG"
FT   gene            572856..573908
FT                   /gene="dnaJ3"
FT                   /locus_tag="NGR_c05160"
FT   CDS_pept        572856..573908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ3"
FT                   /locus_tag="NGR_c05160"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05160"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24312"
FT                   /db_xref="GOA:C3MHI4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHI4"
FT                   /protein_id="ACP24312.1"
FT                   /translation="MRDPYAILGVRRSAGQEEIKTAWRSVAKAIHPDHNQDDPLATERF
FT                   AEAGRAYELLRDPARRNRYDQARREAELRRMEAMKEKMRGPEPAEEPVGTESAEEAISR
FT                   IFGVDPQPAPSAGRPKASASRPAEKTGAAAEAKPDTPAETKHEPASTEATVRRLAAPGT
FT                   ELVAAIVRRIRDRITKTAEKVPDLVVDLSVSIDEVIDRARVSLELPDGETVKVAIPPGA
FT                   TDGQVVRLREQGYRVAGMTRGDVVATLRICQDGPFRTRGLDLVTTLPLDLQDAVLGCET
FT                   TIETPNGTATVEVPAWSGSDKVIRIPGKGLNGAYGQYGDLLVELRLVLHEKPDDKVTDL
FT                   MRSQRDGLYL"
FT   gene            574113..574931
FT                   /gene="fabI3"
FT                   /locus_tag="NGR_c05170"
FT   CDS_pept        574113..574931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI3"
FT                   /locus_tag="NGR_c05170"
FT                   /product="NADH-enoyl acyl carrier protein reductase"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05170"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24313"
FT                   /db_xref="GOA:C3MHI5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHI5"
FT                   /protein_id="ACP24313.1"
FT                   /translation="MAQASGLMNGKRGVIMGVANNRSIAWGIAKALAEAGADIALTWQG
FT                   DALKKRVEPLAQELGAFMAGHCDVTDLATIDGVFSALEEKWGKIDFVVHAIAFSDKDEL
FT                   TGRYLDTSRDNFTRTMDISVYSFTAVAARAERIMNDGGSMLTLTYYGAEKVMPHYNVMG
FT                   VAKAALEASVRYLAVDLGNRGIRVNAISAGPIKTLAASGIGDFRYILKWNEYNAPLKRT
FT                   VSIEEVGNSALYLLSNLSTGVTGEVHHVDSGYHTVGMKAVDAPDISVLKD"
FT   gene            575070..575654
FT                   /gene="gpmB"
FT                   /locus_tag="NGR_c05180"
FT   CDS_pept        575070..575654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmB"
FT                   /locus_tag="NGR_c05180"
FT                   /product="phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05180"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24314"
FT                   /db_xref="GOA:C3MHI6"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHI6"
FT                   /protein_id="ACP24314.1"
FT                   /translation="MLIYMVRHGQTDWNAESRLQGQKDIPLNETGRQQATGNGAALGEI
FT                   LGRDAAGFDFVSSPLGRTRETMERLRRAMGLDPFTYRTDERLKEVSFGAWEGFTLADLK
FT                   RRVPERIAARRVAKWDFIPPGADAESYEILSWRVGAWLKGVREPTVCVSHGGVIRTLFK
FT                   LLGEMEPDEAAAAAIPQDRLLKIVDGSISWL"
FT   gene            complement(575702..575962)
FT                   /locus_tag="NGR_c05190"
FT   CDS_pept        complement(575702..575962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05190"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24315"
FT                   /db_xref="InterPro:IPR009780"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHI7"
FT                   /protein_id="ACP24315.1"
FT                   /translation="MRFVIATLMATASLLSPLSVHAESADVEAVITNIDTEQLSLSLDD
FT                   GKSYQAPEEFNFEGLEAGVKVLVFYTEVDGKRVINDLEIVQ"
FT   gene            576489..577586
FT                   /gene="aroC"
FT                   /locus_tag="NGR_c05200"
FT   CDS_pept        576489..577586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="NGR_c05200"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="5-enolpyruvylshikimate-3-phosphatephospholyase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05200"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24316"
FT                   /db_xref="GOA:C3MHI8"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MHI8"
FT                   /protein_id="ACP24316.1"
FT                   /translation="MSHNSFGHLFRVTTWGESHGPALGCVVDGCPPGIRFTLAEIQAWL
FT                   DKRKPGQSRFVTQRREDDLVKVLSGVMLDDDGETMISTGTPISMMIENTDQRSKDYSEI
FT                   AKRYRPGHADYTYDVKYGIRDYRGGGRSSARETAARVAAGGIARKVVPGLVVRAALVQI
FT                   GKHRINRANWDWSEVNNNPFFAPDPAIVPVWEEYLDGIRKAGSSIGAVVEVIAEGVPAG
FT                   IGAPIYGKLDQDIASNLMSINAVKGVEIGDGFATAELSGEENADEMRIGSDGKPVFLAN
FT                   HAGGILGGIATGQPVVARFAIKPTSSILTERRSIDSDGNEVDVRTKGRHDPCVGIRAVP
FT                   IGEAMLACTIADHYLRDRGQTGRLK"
FT   gene            577607..578707
FT                   /gene="ribA"
FT                   /locus_tag="NGR_c05210"
FT   CDS_pept        577607..578707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="NGR_c05210"
FT                   /product="riboflavin biosynthesis protein"
FT                   /EC_number="3.5.4.25"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05210"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24317"
FT                   /db_xref="GOA:C3MHI9"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHI9"
FT                   /protein_id="ACP24317.1"
FT                   /translation="MSYDQKRVVEAIRAFEAGEIVVVTDDGGRENEGDLIVAAVHCTSE
FT                   KMAFIVRHTSGIVCAPMPRDEAKRLNLNAMVAENDSAHTTAFTVSVDFKHGTTTGISAD
FT                   DRTLTVRNLANPNVGATDFVRPGHIFPLVAREGGVLMRSGHTEAAVDLCKLASLPPIGV
FT                   ICELVNDDGTVTRGPQVEAFAETHGLKQVSVADLIAYRQRKETLIEKANSFAIETAYGR
FT                   AKAHTYSLPWDPMQHLAVVFGDVRDGVDIPVRLHLENVGADVFGNDRQIDEIMKRIAGE
FT                   GRGVIVYLREGSVGVGVSQTARKGKHEREAHSEAQARESEWLEIGLGAQILKDLGITSI
FT                   RLLSSRERHYVGLEGFGIKIAATEIL"
FT   gene            complement(578785..579315)
FT                   /locus_tag="NGR_c05220"
FT   CDS_pept        complement(578785..579315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05220"
FT                   /product="invasion associated locus B"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05220"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24318"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHJ0"
FT                   /protein_id="ACP24318.1"
FT                   /translation="MGLSLFSRLPALIALGIAAFVLPAASMAQQSAATPGTVKSNHGAW
FT                   SIVCDQPAGASAEQCALMQNVIAEDRPEVGLSVVVLKTADRKAKILRVLAPLGVLLPNG
FT                   LGLNVDGKDIGRAYFVRCFSDGCYAEVVLEDELLKTLRAGGTATFIVFQSPEEGVGIPV
FT                   DLKGFGEGYDALP"
FT   gene            579704..580588
FT                   /gene="ctaC"
FT                   /locus_tag="NGR_c05230"
FT   CDS_pept        579704..580588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaC"
FT                   /locus_tag="NGR_c05230"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05230"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24319"
FT                   /db_xref="GOA:C3MHJ1"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHJ1"
FT                   /protein_id="ACP24319.1"
FT                   /translation="MKNKAYAVLAALACLLFASSAFADKPVDWQTRFQAAATGIMEEIT
FT                   WFEQYTLWFIIPITLLVLLLLIIVVVKFREGANPVPSRTSHNTAIEVIWTVGPVIILLF
FT                   LAIPSFKLLNAQLTPPQNPDLTVKATGNQWYWSYEYEVGENPLSFDSLLLKDEDRASAG
FT                   KEDKAAYPRLLAVDNEVVVPVGKTVRLLVTAADVIHAFAMPAFGVKIDAVPGRLNETWF
FT                   KAAREGLYYGQCSELCGKDHAYMPIAVRVVSQEKYDAWLAAAATNLGEANKALMASIDG
FT                   AAKTVDVAANAAQ"
FT   gene            580609..582300
FT                   /gene="ctaD"
FT                   /locus_tag="NGR_c05240"
FT   CDS_pept        580609..582300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaD"
FT                   /locus_tag="NGR_c05240"
FT                   /product="cytochrome o ubiquinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05240"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24320"
FT                   /db_xref="GOA:C3MHJ2"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHJ2"
FT                   /protein_id="ACP24320.1"
FT                   /translation="MAGTAVHHDHRHDHSDHAHDADHAHKPLTFFQRWFLSTNHKDIGT
FT                   LYLIFGIIAGLIGGTLSVFMRAELQEPGIQIFHGLAQMVYGFEGDAAIDGGKHMFNVFT
FT                   TAHALIMIFFMVMPALIGGFANWMVPIMIGAPDMAFPRMNNISFWLIVPAFLLVLLSMF
FT                   VEGPAGAYGAGGGWTIYPPFSTSGMPGPAMDLAILGLHIAGASSILGAINFITTILNMR
FT                   APGMTLHKMPLFAWSVLITAFLLLLSLPVLAGAITMLLTDRNFGTTFFAPEGGGDPILF
FT                   QHLFWFFGHPEVYILILPGFGIVSHIISTFSRKPIFGYLGMAYAMVAIGAVGFIVWAHH
FT                   MYTVGMSLETQRYFVFATMVIAVPTGVKIFSWIATMWGGSIRFTTPMVWAIGFIFLFTV
FT                   GGVTGVQLANAGLDRALHDTYYVVAHFHYVLSLGAVFAIFAAWYYWFPKMSGYMYSEFL
FT                   GKLHFWVMFVGVNLIFFPQHFLGLAGMPRRYIDYPDAFAGWNMVSSYGSYIAAVGVLIF
FT                   LFGVAEAFAKKRVAGDNPWGEGANTLEWQLSSPPPFHQWEQLPRIK"
FT   gene            582399..583355
FT                   /gene="ctaB"
FT                   /locus_tag="NGR_c05250"
FT   CDS_pept        582399..583355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaB"
FT                   /locus_tag="NGR_c05250"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05250"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24321"
FT                   /db_xref="GOA:C3MHJ3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MHJ3"
FT                   /protein_id="ACP24321.1"
FT                   /translation="MTLIDNHEAVGMEGVPRLSEASARDYFELLKPRVMSLVVFTAFAG
FT                   LVLAPGQINPVIGFIAILCIAIGAGASGALNMWYDADIDAVMSRTAKRPIPAGKILPQE
FT                   ALAFGLTLSAFSVIILGLAVNWLAAGLLAFTIFFYVVIYTMWLKRSTPQNIVIGGAAGA
FT                   FPPMIGWACVTGGVSVESIVLFLIIFLWTPAHFWALALFKMGDYGAVGVPMMPNVCGEA
FT                   TTKRQIVVYALLTALSGICPTLLGFASLGYGAFATALGLGFIWYSLAVLRMPEADKRML
FT                   PAKKLFAFSIAYLFAIFSALLVDYMIAHVWLDAGGII"
FT   gene            583355..583495
FT                   /locus_tag="NGR_c05260"
FT   CDS_pept        583355..583495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05260"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24322"
FT                   /db_xref="GOA:C3MHJ4"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHJ4"
FT                   /protein_id="ACP24322.1"
FT                   /translation="METVKLSETQKKSRRGRNIALGLVLAGLVGLFYVVTLIKFGGGMA
FT                   N"
FT   gene            583509..584108
FT                   /gene="ctaG"
FT                   /locus_tag="NGR_c05270"
FT   CDS_pept        583509..584108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaG"
FT                   /locus_tag="NGR_c05270"
FT                   /product="cytochrome c oxidase assembly protein CtaG"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05270"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24323"
FT                   /db_xref="GOA:C3MHJ5"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MHJ5"
FT                   /protein_id="ACP24323.1"
FT                   /translation="MTNTPQTPPKERANGVIVGACLAFVAGMVGMAYAAVPLYDMFCRV
FT                   TGYNGTTQRVEQASDVILDEKIKVTFDANVGPGLAWDFKPVQRDIDVRIGETVQVMYRA
FT                   KNLSSKPATGQATFNVTPMAAGAYFNKVQCFCFTETTLQPGEEMEMPVVFFVDPEIVKP
FT                   VETKDIKTLTLSYTFYPREPSKPIAAVKDGETENRL"
FT   gene            584171..585049
FT                   /gene="ctaE"
FT                   /locus_tag="NGR_c05280"
FT   CDS_pept        584171..585049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaE"
FT                   /locus_tag="NGR_c05280"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05280"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24324"
FT                   /db_xref="GOA:C3MHJ6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHJ6"
FT                   /protein_id="ACP24324.1"
FT                   /translation="MAGAHQKNHDYHIIDPSPWPLLASIGAFVMAFGGVGLMRYVAGGS
FT                   FKLFGLELANPWLFLIGLAIVLYTMFGWWSDTIKEGREGHHTRVVSLHLRYGMIMFIAS
FT                   EVMFFAAWFWAFFDASLFAGEPIQAARAAYTGGVWPPKGIEVLDPWHLPLYNTVILLLS
FT                   GTTVTWAHHALLHNDRKGLISGLTLTVLLGVLFSFVQGYEYAHAPFAFRDSIYGATFFM
FT                   ATGFHGFHVLVGTIFLLVCLFRALGGGFSQQHHFGFEAAAWYWHFVDVVWLFLFFSIYI
FT                   WGGWGAPIAHG"
FT   gene            585022..585624
FT                   /locus_tag="NGR_c05290"
FT   CDS_pept        585022..585624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05290"
FT                   /product="lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05290"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24325"
FT                   /db_xref="GOA:C3MHJ7"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHJ7"
FT                   /protein_id="ACP24325.1"
FT                   /translation="MGRADRARLRPARCEDKGRLRRRGRPISLESYGRTMKNAYVFPLA
FT                   AALLLSGLFPALGAETADKVVVHKERRVLQLFQGERLLREFPIALGGNPVGDKLQEGDR
FT                   RTPEGLYVLDWRNDASSFYRSMHVSYPAPEDVQAAAAKVVDPGGMIMIHGQPNYLGWLA
FT                   FLTQMFDWTDGCIAVTNAEMDEIWDMVPNNTAIEINP"
FT   gene            585621..586004
FT                   /locus_tag="NGR_c05300"
FT   CDS_pept        585621..586004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05300"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24326"
FT                   /db_xref="GOA:C3MHJ8"
FT                   /db_xref="InterPro:IPR009325"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHJ8"
FT                   /protein_id="ACP24326.1"
FT                   /translation="MNDDKALYPPVDPIVAGIKGLCPRCGQGHVFDGFLKVRPACENCE
FT                   LDYRFADSGDGPVVFVILIVGFIVVGAALWMEVNLNPPLWLHFLLWIPLATVFSLVLTR
FT                   MLKGVLINLQYRNNARSGEIDRG"
FT   gene            585973..586758
FT                   /locus_tag="NGR_c05310"
FT   CDS_pept        585973..586758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05310"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24327"
FT                   /db_xref="GOA:C3MHJ9"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHJ9"
FT                   /protein_id="ACP24327.1"
FT                   /translation="MRVRAKLTVAEAHRSTSRGHFGPIAGLVLVAITFVVLIALGTWQV
FT                   ERLQWKEALIAAIAERRSAPPVSVEEIEAMAAAGEDVDYRTTRVSGVYDHDKERHFFAT
FT                   HEGRTGYYVFTPLMLADGRALFVNRGFVPFERKDAATRPEGEVTGNVTIDGLARPRLSE
FT                   KPSSLVPDNDLAKNIFYWKDLDAMASTAGIAADRVLPFFVDADASKNPGGLPIGGVTQF
FT                   DLPNNHLQYALTWYGLAAALVVVSGAYLYRQGRKDVSKN"
FT   gene            586771..587136
FT                   /locus_tag="NGR_c05320"
FT   CDS_pept        586771..587136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05320"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05320"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24328"
FT                   /db_xref="GOA:C3MHK0"
FT                   /db_xref="InterPro:IPR009732"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHK0"
FT                   /protein_id="ACP24328.1"
FT                   /translation="MGILAAILIVLTALLHVGFLVLEMFLWTKPQGRAVFRMTAERAET
FT                   TWVLAANQGLYNGFLAAGLLWSLIQPEPAFALQLKVFFLVCVIVAAIYGAWSVKPRILL
FT                   VQGGPAMLALLFVLLAS"
FT   gene            587140..588150
FT                   /gene="lytB"
FT                   /locus_tag="NGR_c05330"
FT   CDS_pept        587140..588150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lytB"
FT                   /locus_tag="NGR_c05330"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05330"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24329"
FT                   /db_xref="GOA:C3MHK1"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHK1"
FT                   /protein_id="ACP24329.1"
FT                   /translation="MASSTAEKSPITIRLCGPRGFCAGVDRAIQIVVLALKEFGAPVYV
FT                   RHEIVHNRYVVEGLEAKGAIFVEELDEIPPEHRKQPVVFSAHGVPKSVPADADQRNLFY
FT                   LDATCPLVSKVHKQAMRHHRLGRHVVLIGHAGHPEVIGTMGQLPEGTVSLIETVEDADA
FT                   YVPPDPDNLGFVTQTTLSVDDTAGVIKRLHERFPNLTAPAADSICYATTNRQEAVKQAA
FT                   PGCDLFLVVGAPNSSNSKRLVEVALRAGAKHAVLVQRASEIDWDTLGDITTVGLSAGAS
FT                   APEVIVNEIIEAFRERYQAAVELADTVEENENFLVNRELRHVELTAADMAFVNGE"
FT   gene            588209..589189
FT                   /gene="thrB"
FT                   /locus_tag="NGR_c05340"
FT   CDS_pept        588209..589189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="NGR_c05340"
FT                   /product="homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05340"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24330"
FT                   /db_xref="GOA:C3MHK2"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MHK2"
FT                   /protein_id="ACP24330.1"
FT                   /translation="MAVYTDITEDELAGFLAAYDVGTLTSYKGIAEGVENSNFLLHTTR
FT                   GSYILTLYEKRVNADDLPFFLGLMHHLAERGLSCPLPLPRADGALLGTLSGRPAAVISF
FT                   LEGMWLRKPEAQHCREVGRALASMHEAGEGFALTRANALSVGGWRPLWRNSEARADEVQ
FT                   DGLKEDIAAELAYLEDHWPRNLPQGVIHADLFPDNVFFLGDRLSGLIDFYFACNDFLAY
FT                   DIAVCLNSWCFEKNGSYNITKGMALLSGYESVRKLTAEEVSALPLLARGSALRFFLTRL
FT                   YDWLMTPAGALVVKKDPLEYLTKLRFHRAVVSSAEYGLRRDEASQ"
FT   gene            589186..589647
FT                   /gene="rnhA"
FT                   /locus_tag="NGR_c05350"
FT   CDS_pept        589186..589647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="NGR_c05350"
FT                   /product="ribonuclease H"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05350"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24331"
FT                   /db_xref="GOA:C3MHK3"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHK3"
FT                   /protein_id="ACP24331.1"
FT                   /translation="MKHVDIFTDGACSGNPGPGGWGAVLRYGEVEKEMFGGEAETTNNR
FT                   MELMAAISALNALKQPCEVDLHTDSKYVMDGISKWIHGWKRNGWKTGDRKPVKNGELWQ
FT                   ALDEARDRHQVTWHWVKGHAGHPENERADELARKGMEPFKKVRRTDAVK"
FT   gene            590015..590965
FT                   /locus_tag="NGR_c05360"
FT   CDS_pept        590015..590965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05360"
FT                   /product="putative transposase for insertion sequence
FT                   NGRIS-21a"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05360"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24332"
FT                   /db_xref="GOA:C3MHK4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHK4"
FT                   /protein_id="ACP24332.1"
FT                   /translation="MSNISMICAGIDVAKDRLEVAVHPGGARLDVGNDAAGLQALDAFL
FT                   DTHGVQRVGFEASGGYEWRLMAHLRQGPRPAARLQPAQVRAFAKSRLQRAKNDRLDARL
FT                   IAAFTAALERLPELPEARFDNLAAELTYLEQIEQQIALVKTFAEAALTDSIRRRHQRQI
FT                   ETLTKKREAEIERIAKAMRADAQLSRRLDLLVSIKGIGLRSALALVIRLPELGQASREE
FT                   VAALVGVAPFDDDTGKRCGIRHIDGGRERLRKAVFMCAFTAARHNPDLAAFYKRLRQKG
FT                   KDHKLAVIAVARKLVVLANAVVARGSEWTPRYQHP"
FT   gene            complement(591088..591573)
FT                   /locus_tag="NGR_c05370"
FT   CDS_pept        complement(591088..591573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05370"
FT                   /product="peroxiredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05370"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24333"
FT                   /db_xref="GOA:C3MHK5"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037944"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHK5"
FT                   /protein_id="ACP24333.1"
FT                   /translation="MTIAVGDKLPNATFKEKTADGPVEVTTDQLFKGKRVVLFAVPGAF
FT                   TPTCSLNHLPGYLENRDAILARGVDDIAVVAVNDLHVMGAWATSSGGMGKIHFLSDWNA
FT                   AFTKALGLDIDLSAGTLGIRSKRYSMLVEDGVVKALNVEDAPGQATVSGAAAMLEQL"
FT   gene            complement(591645..592460)
FT                   /locus_tag="NGR_c05380"
FT   CDS_pept        complement(591645..592460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05380"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24334"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHK6"
FT                   /protein_id="ACP24334.1"
FT                   /translation="MAQGLAKASLLAAIFLPMPSQAASSAWVTSPGGAIRLVASQPRPD
FT                   GSIPAIVEIKLEPGWKTYWRDPGASGIPPQVTFDPSGGVALEAIRFPAPKTFGEGPGRY
FT                   VGYDSSVAFPLVLRRVSDEKDLAVRATVFLGVCEDICIPVQGTLDLTLKGGEFDNPLDG
FT                   ARIEKAVASLPEPPSDDFRIMKAAFDAAGGVIHLDLRLPRDAGKPEIFLAGPAGFAFGA
FT                   PVVGDAAGAERRVDIPLKLSGKDRKVAGKPIALTVRAGDRSMETTLAFD"
FT   gene            592735..593340
FT                   /locus_tag="NGR_c05390"
FT   CDS_pept        592735..593340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05390"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24335"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MHK7"
FT                   /protein_id="ACP24335.1"
FT                   /translation="MATAVQQKIRERGFLDGQFLIAMPSMFDANFARTVIFVCAHSEDG
FT                   AMGFVLNRPQRLTFPDVLLHLQLLDPDEVIRLPSAAREFQIQAGGPVETGRGFVLHSDD
FT                   YLSDSSIPVSDDICLTATLDIVKAISRGEGPLKATMLLGYAGWGPGQLENEISSNGWLT
FT                   CPAREELIFSRDLDEKYDRALALMGISPAMLSSDAGHA"
FT   gene            complement(593365..596280)
FT                   /locus_tag="NGR_c05400"
FT   CDS_pept        complement(593365..596280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05400"
FT                   /product="putative diguanylate cyclase
FT                   (GGDEF)/phosphodiesterase (EAL) with PAS domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05400"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24336"
FT                   /db_xref="GOA:C3MHK8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHK8"
FT                   /protein_id="ACP24336.1"
FT                   /translation="MMPLTRKPFASSTARLAAFLVAFAVFIFGVAGGVAHALEPVKISR
FT                   EDTALDLTATTEIYSGRGEAFQVSTAPGTDGIVRRIEVRSSTEHHQGDWAVFALANVSE
FT                   EQLERVIVAPHFRLVNSKLFWPDLGSQRILSITPSEGFALDRQPSDEADVFRITLNPGA
FT                   VITFVAELATPELPQIYLWQPDAYKDTVNAFTLYRGIVLGIAGLLAVFLTILFVVKGTS
FT                   MLPATAALAWAVLAYICVDFGFLSKLISVTAGDERIWRAGTEVFLAAGLVIFLFTYLNL
FT                   NRWHQHLGYATLAWILGLALLFGVAVYDPAIASGIARLSFALTATVGIVLIAYLGFNRY
FT                   DRAILLVPAWLLILVWLFGAWLAVTGQLANDIVQPALGGGLVLIVLLIGFTVMQHAFAG
FT                   GAYQQGLFSDLERQALALTGSGDTVWDWDVARDRVVTIPDISHQLGLSLGTMNGPVRNW
FT                   VPRLHPDDRDRFRATLDVLLEHRRGRLNHEFRARAEDGHYHWLSIRARPVLGANGEIIR
FT                   CVGTIVDITEQRNSVERLLQNALLDNLTGLPNRQVFLDRLQAILLMSDGTNAVRPTVLA
FT                   IDIDRYKQVNDLLGIAAGDNILIALTRRLRRLLRPQDTLARLGGDQFGLILMSERDPAK
FT                   IADFADAVSKAIMVPLNYGNREINLTASIGLVSWLDQEQSAASLLDDAELAMFRAKKEG
FT                   GNRVEPFRPAFRTSGSDRLQLEADLKRAIERKELSLVYQPIVRLSDAEVAGFEALMRWD
FT                   HPKRGNVSPTEFIPIAENSDIINQLGMFAFDQATSDLSEWQIQTGDLPIFVSINLSSAQ
FT                   LLNSGLYDDVRAILNKNRCDPAKVKMELTESLVMENPEQARLVLEKLREAGLRLALDDF
FT                   GTGHSSLSYLTRFPFDTIKIDKALVRDPSDKRGVVLRSVIAMARELDMRVVAEGIESEE
FT                   DAIQLAQMGCDYGQSFLFGPPVGSESILRLLKERFPLMKRA"
FT   gene            complement(596277..596888)
FT                   /gene="rimJ"
FT                   /locus_tag="NGR_c05410"
FT   CDS_pept        complement(596277..596888)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimJ"
FT                   /locus_tag="NGR_c05410"
FT                   /product="ribosomal-protein (S5)-alanine
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05410"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24337"
FT                   /db_xref="GOA:C3MHK9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHK9"
FT                   /protein_id="ACP24337.1"
FT                   /translation="MARSVFRFLSRQPESVEIANEDYLLRLPRYADYRQWYQLRSASRS
FT                   FLEPWEPSWRTDEMTESAFRGRVIRNEQEFASGQAVPLFLFHKHDEVLLGGLTIGHIRR
FT                   GAAQNCMIGYWMGQKYAGQGHMHAALQLTIPYIFSTLELHRIEAACIPENTRSIRLLEK
FT                   AGFEREGYLRQYLKINGQWRDHLMFSLLSADAVPSRNMPL"
FT   gene            complement(597154..598452)
FT                   /locus_tag="NGR_c05420"
FT   CDS_pept        complement(597154..598452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05420"
FT                   /product="peptidase, family M16 protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05420"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24338"
FT                   /db_xref="GOA:C3MHL0"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHL0"
FT                   /protein_id="ACP24338.1"
FT                   /translation="MMKVECTRLPSGLTVVTERMPHLESVALGVWIKSGSRNETVDEHG
FT                   IAHLLEHMAFKGTRRRSARQIAEEIENVGGEVNAATSTETTSYYARVLKDHVPLAIDIL
FT                   ADILTESTFDEEELRREKHVILQEIGAADDTPDDVVFDRFAETAYRDQTVGRPILGTPE
FT                   TVMSFTPGQIRQYLGRNYTTDRMFIVAAGAVDHDSIVRQVQERFSSLPVAPLSPPVLDT
FT                   ARYTGGDSRESRDLMDAQVLLGFEGRAYHARDFYCSQILANILGGGMSSRLFQEVREHR
FT                   GLCYSVYAFHWGFSDTGIFGIHAATGGENLPELMPVIIDELRKSSTSIDQQEIERARAQ
FT                   IRAQLLMGQESPAARAGQIARQMMLYGRPIPNEELMERLSGITIERLTDLAGRLFFDTA
FT                   PTLSAIGPLDQLAPMSDILSSLNTKSAVHALAG"
FT   gene            complement(598467..599864)
FT                   /gene="thrC"
FT                   /locus_tag="NGR_c05430"
FT   CDS_pept        complement(598467..599864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="NGR_c05430"
FT                   /product="threonine synthetase protein"
FT                   /EC_number="4.2.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05430"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24339"
FT                   /db_xref="GOA:C3MHL1"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHL1"
FT                   /protein_id="ACP24339.1"
FT                   /translation="MKYISTRGEAAPLGFCDALLAGLARDGGLYLPKEWPTFSKKEIRA
FT                   LRGKSYQEIAFTVLQPFTNGEIPAAKFREMIDGAYATFRHPAIAPLVQTGPNAFVMELF
FT                   HGSTLAFKDVAMQLLARLMDHVLAERGERATIVGATSGDTGGAAIDAFAGRDRTDIFIL
FT                   FPHGKVSPVQQRQMTTANASNVHAIAVNGNFDDCQNLVKAMFNDTAFRDRVKLSGVNSI
FT                   NWARIMAQIVYYFTTAIALGGPDRKISFTVPTGNFGDIFAGYVAKRMGLPIDKLIIATN
FT                   ENDILARTLKTGRYEMREVKATTSPSMDIQISSNFERLLFEAFGREASEVRAAMASLKQ
FT                   SGSFAIEEGALKKIRKEFRAGRASEKQVAATIRDTFKKSGYLLDPHTAIGVSVAAKHEK
FT                   PSAPMVVLGTAHPAKFPDAVKSASGIDPTLPTWLADLMTRAERFDILDAELKNVETFIG
FT                   ERTRVQK"
FT   gene            600282..600830
FT                   /locus_tag="NGR_c05440"
FT   CDS_pept        600282..600830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05440"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24340"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHL2"
FT                   /protein_id="ACP24340.1"
FT                   /translation="MSGNVSRHLLAMSVLLVAAGCNQTQNGGAIEAGGNANAPTPAVIQ
FT                   AACPPVMLRDGTASYRTYAKGGKDDPTKVVYQASLADTTRQCVQSADSLTVTVVAQGRV
FT                   VAGPAGGPGKLTMPIRVAATDGEKTLYSELTQYPVEIPTGSTTTQFVFTKADVTLPAGA
FT                   GSDAKIFVGFDEGPQKAKQ"
FT   gene            complement(600926..602032)
FT                   /locus_tag="NGR_c05450"
FT   CDS_pept        complement(600926..602032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05450"
FT                   /product="amino acid ABC transporter, substrate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05450"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24341"
FT                   /db_xref="GOA:C3MHL3"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHL3"
FT                   /protein_id="ACP24341.1"
FT                   /translation="MRLSLLTGMTLAAGMAFAPLAHADITLGVITPLTGPVAAFGEQVK
FT                   NGAEAAVEAINDAGGIKGEKLVLKIVDDAGEPKQSVSVSNQLAGEGVRYVVGPVLSGTA
FT                   MPASDVLAENGILMVTPTATTPDLTTRGLWNVLRTCGRDDQQAVVAADYVVKNLKDKRV
FT                   AVLHDKGAYGKGLADGFKAAINAGGITEVVYEGLNPGEKDFSAIVTRLKAENVDVVYFG
FT                   GYHAEAGLMIRQMRDQGVNAQLIGGDGLSNTEFWAIGADAAEGTIFTNASDATRNPAAA
FT                   PVIEALKAKNIPAEAFTLNAYAAVQVIKAGIEMAGSAEDATAVATAIKSGEEIDTVIGK
FT                   LTFGESGDLTSPSFSLYKWEAGKSVAAE"
FT   gene            complement(602415..603110)
FT                   /locus_tag="NGR_c05460"
FT   CDS_pept        complement(602415..603110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05460"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24342"
FT                   /db_xref="GOA:C3MHL4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHL4"
FT                   /protein_id="ACP24342.1"
FT                   /translation="MTGIDLIIFDCDGVLVDSEIIASEVQAELVSEAGFPISVEEMNER
FT                   FAGLTWRDTLLTIEREASIPLSASLIDRVDTILDKRLARDVKIIDGVKPVLLQLTLPHC
FT                   ICSNSTSARLATMLGKVGIKDHFGKHIYSARDLGPDRVKPKPDIFLHGAAQFGVDPARV
FT                   LVIEDSVHGVHGARAAGMRVVGFTGGSHTYPSHADKLTDAGAETVVSRMAALPGVIAAL
FT                   AEWSESLTA"
FT   gene            603283..603951
FT                   /locus_tag="NGR_c05470"
FT   CDS_pept        603283..603951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05470"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05470"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24343"
FT                   /db_xref="GOA:C3MHL5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHL5"
FT                   /protein_id="ACP24343.1"
FT                   /translation="MKKEHDDTLASRISRALAERIISGTLSPGERLRQDHVAEEFGASH
FT                   VPVREAFRRLEAQGLAVSEPRRGVRVASFDLKEVREVAEMRAALEVLALRHAIPHLTPA
FT                   ILDRAEAATVAAERSRDVRNWEAANRAFHRLILEPCAMPRLLAAIDDLHATSARFLFSA
FT                   WRSSWEARTDHDHRAILAALRQGRGEEAAIILERHVGWIGKTPVKTAGGEVRDAFSIVG
FT                   "
FT   gene            604003..604422
FT                   /locus_tag="NGR_c05480"
FT   CDS_pept        604003..604422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05480"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24344"
FT                   /db_xref="InterPro:IPR009702"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHL6"
FT                   /protein_id="ACP24344.1"
FT                   /translation="MVRLRGHHLLCLLTFVGEGYTPAFTGNFRLIAARLSNGEAIEIVE
FT                   GPDDICVPMLDRPEAHCRNTDIRDRDAWALAAIGERLGIALKAGSILNLDGQRLDALRA
FT                   AFAAGLIRAACHECEWSGFCTRIARDGFEGTLVQS"
FT   gene            complement(604473..605153)
FT                   /locus_tag="NGR_c05490"
FT   CDS_pept        complement(604473..605153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05490"
FT                   /product="probable transcriptional regulator protein, ArsR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05490"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24345"
FT                   /db_xref="GOA:C3MHL7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHL7"
FT                   /protein_id="ACP24345.1"
FT                   /translation="MKEGPDIALIGSLIGDPARANILTALMAGQALTPTELAAHAGITL
FT                   QTASSHLAKLEAGGLLTQRKQGRHRYYALSEDEVGLMLESLMGFAASRGLTRHRPGPKD
FT                   PALRKARVCYNHLAGDYGVRLLDSLVAARQIEVTGDDLALTDAGRDRVEALGIDYDALS
FT                   KSRRPICRTCLDWSERRSHLAGSLGEALLTLFIDKGWAKREKDSRAVRFSDKGEKAFLE
FT                   FFPL"
FT   gene            605328..605648
FT                   /locus_tag="NGR_c05500"
FT   CDS_pept        605328..605648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05500"
FT                   /product="NIPSNAP family containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05500"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24346"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHL8"
FT                   /protein_id="ACP24346.1"
FT                   /translation="MLTCFIRYEIDPFRKEDFATYARNWGEAIPRCGADLIGYFGPHEG
FT                   SATAAYGVYNIESLAAYEAYRARLAADPLGRENYEFARRERFILKEDRIFLKNLPLPYG
FT                   KE"
FT   gene            605653..606009
FT                   /locus_tag="NGR_c05510"
FT   CDS_pept        605653..606009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05510"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05510"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24347"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHL9"
FT                   /protein_id="ACP24347.1"
FT                   /translation="MIAVIFEVLPSEGERATYLGLAADLRPLLDRIDGFISIERFQSLA
FT                   DPNKLLSLSFWRDEEAVKAWRNGAEHRAAQGAGRNGVFADYRLRIAAVVRDYGLNHRDE
FT                   APADSRQWHEGNAA"
FT   gene            606128..607258
FT                   /gene="ccrM"
FT                   /locus_tag="NGR_c05520"
FT   CDS_pept        606128..607258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccrM"
FT                   /locus_tag="NGR_c05520"
FT                   /product="modification methylase SmeIP"
FT                   /EC_number="2.1.1.72"
FT                   /note="Adenine-specificmethyltransferase SmeIP; M.SmeI;
FT                   M.CcrMI"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05520"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24348"
FT                   /db_xref="GOA:C3MHM0"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040843"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHM0"
FT                   /protein_id="ACP24348.1"
FT                   /translation="MSSVVSLAEISRAARPLSWLDSIIKGDCVAALNALPDNSVDVVFA
FT                   DPPYNLQLGGMLHRPDQSLVDAVDDEWDQFASFEAYDAFTRAWLLACRRVLKPTGTLWV
FT                   IGSYHNIFRVGAILQDLHFWILNDIIWRKTNPMPNFKGRRFQNAHETLIWATPNAKAKG
FT                   YTFNYEAMKAANDDVQMRSDWLFPICSGGERLKGDDGKKVHPTQKPEALLARILMASTK
FT                   PGDVVLDPFFGSGTTGAVAKRLGRHFVGIEREQDYIDAAAERIAAVEPLGKATLSVMTG
FT                   KKAEPRVAFNTLIESGLIKPGTVLTDAKRRYSAIVRADGTLASGGEAGSIHRLGAKVQG
FT                   LDACNGWTFWHFEAGGTLKPIDELRSVIRNDLAKLN"
FT   gene            607776..609026
FT                   /locus_tag="NGR_c05530"
FT   CDS_pept        607776..609026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05530"
FT                   /product="putative transposase for insertion sequence
FT                   NGRIS-13i"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05530"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24349"
FT                   /db_xref="GOA:C3M8X8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C3M8X8"
FT                   /protein_id="ACP24349.1"
FT                   /translation="MTDQKQFYAGVDWASESHHVFLTDGDGRKIGERVFRHGGEGLAEL
FT                   AAWLTATSGATEAGQIQVAIEVPHGPVVETLIERGCQVHAINPKQMDRFRDRFTLAGAK
FT                   DDSRDAEVMASALRTDRRCFRLLAAADPVVIELREWSRMAEDLGAERNRLTNRMREQLW
FT                   RYFPALLELENDLGAEWLLDLWEAVPTPAKAARIRAATIAKLLKRNRIRRVDATHVLAV
FT                   LRTPPVKVAAGTTEAASAHIATLIARIRLVNRQLKQAHQRLDTLTARLVPTEATEPGQR
FT                   KQHDVEILASLPGVGRIVLATLLAEAFDALQRRDHAALRSLTGVAPVTKRSGKSCIVIR
FT                   RQACHDRLANAMYHWARVAIQHDSRSRLKYAALRSRGHSHGRALRSVADRLLNVACAML
FT                   KTGTTFNPSLAEQKLSC"
FT   gene            complement(609118..610155)
FT                   /locus_tag="NGR_c05540"
FT   CDS_pept        complement(609118..610155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05540"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24350"
FT                   /db_xref="GOA:C3MHM2"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHM2"
FT                   /protein_id="ACP24350.1"
FT                   /translation="MVTRIYGSNFADILKQNSYIEVEIYGYDGDDDIYLNRTDSYGGYN
FT                   FVDAGYGNDLVVNYYEGGNDIYMGAGNDIYVADIRARDTSSYDVVYGGSGNDRFEINGY
FT                   ASDYYGESGNDTFLSAGFNNYFNGGTGIDAISYQFQDDWSSERGKGVTIDLGYKYATTG
FT                   SGRREDLISIENATGTNYGHDDIAGSSVANTLRGLGGHDILEGLGGDDFLDGGSGDDDL
FT                   YGGSGADILRGGTGFDYLVGGTGTDSFDFNAISESVVGSRRDVIADFHRSEYDVIDLST
FT                   IDADTTWSGNQKFTYIGGSAFTGDAGQLNFRSGILSGDINGDGLADFQIKVNGVTSLRV
FT                   DDFFL"
FT   gene            complement(610285..610947)
FT                   /locus_tag="NGR_c05550"
FT   CDS_pept        complement(610285..610947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05550"
FT                   /product="putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05550"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24351"
FT                   /db_xref="GOA:C3MHM3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHM3"
FT                   /protein_id="ACP24351.1"
FT                   /translation="MSSVDIRHIVFDIGKVLIHYDPQIPYSRIIPDEAERHWFFANVCT
FT                   HDWNIEQDRGRSWEEAETLLIRDHPEREEQIRAFRRHWHEMVPHAYTETVSLLESLIAE
FT                   GRDVTMLTNFASDTFREAQKRFPFLTLPRGVTVSGDVGLIKPDVDIYRTHAQTFGLEPA
FT                   ATIFIDDSLANVEGARAAGWHAIHFTDARALSADLVAYGVQPLGDLDASGPTAATRV"
FT   gene            complement(611004..612092)
FT                   /locus_tag="NGR_c05560"
FT   CDS_pept        complement(611004..612092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05560"
FT                   /product="putative A/G-specific adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05560"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24352"
FT                   /db_xref="GOA:C3MHM4"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHM4"
FT                   /protein_id="ACP24352.1"
FT                   /translation="MTLDTLKAADAAPLLLDWYDRHHRDLPWRVSPPMAARGAVADPYH
FT                   VWLSEVMLQQTTVQAVKAYFDKFLRLWPRVEDLAAAETEEVMKAWAGLGYYARARNLKK
FT                   CAEVVAREHGGRFPDREEGLKSLPGVGDYTAAAIAAIAFNRHSAVLDGNVERVISRLYA
FT                   IETPLPAAKPEMRRLVSELTPLDRPGDFAQAMMDLGATICAPKRPACALCPFRGNCRAL
FT                   TVADPETFPRKAARKEKPLRLGAAFVAIDRSDAVYLRKRADSGLLGGMTEVPGTDWTAR
FT                   RDGETSIEAGPFAAAWEACGTVTHVFTHFELRLSVYRAEVGDMAACAEGWWEPIASLKA
FT                   QALPTVMKKAITQAIPHAFKAV"
FT   gene            612449..612955
FT                   /locus_tag="NGR_c05570"
FT   CDS_pept        612449..612955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05570"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05570"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24353"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR010593"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHM5"
FT                   /protein_id="ACP24353.1"
FT                   /translation="MSEAKSRKGVVQISEVANGLIDPVLAKRAGINTMLLGSWDEIAGT
FT                   EFADCTRPEKIAWPRRASEIGGDGGYQPGVLTVACEGARALFLTHAQGELIQRINGFFG
FT                   FHAIGQLRIVQKPVAAPPKPYRRPRPLTGEPARRLDTMVEGIESEALRSALKRLGTAVL
FT                   SERRK"
FT   gene            613077..613883
FT                   /locus_tag="NGR_c05580"
FT   CDS_pept        613077..613883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05580"
FT                   /product="putative disulfide bond formation protein D"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05580"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24354"
FT                   /db_xref="GOA:C3MHM6"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHM6"
FT                   /protein_id="ACP24354.1"
FT                   /translation="MSASVTSLPKRLLSGVAIAALALVLAACSEEKKEAASKAPAETSA
FT                   SADAMTTASTTATPAASRAKPAGTEVAQAAAPAKAELPQSEGSVDVQKLMEPGALPEMA
FT                   LGEANAPVTIVEYMSMTCPHCANFHNKTFDAIKAKYIDSGKVRFIVREFPFDPRAAAAF
FT                   MLARCAPEGQYFPMVSMLFKQQEQWAAAENGRDALLQMSKLAGFTQESFEACLTNQKLL
FT                   DDVNAVMQRGAKEFGVKSTPTFFVNGEHYSGDMSVDVLSALIDSKL"
FT   gene            613970..614341
FT                   /locus_tag="NGR_c05590"
FT   CDS_pept        613970..614341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05590"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24355"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHM7"
FT                   /protein_id="ACP24355.1"
FT                   /translation="MPHADVPPKARANARRMRSAMTDAELKLWSELRAHRLLGLAFRRQ
FT                   VPVAGYIVDFACAEHRLIIEVDGSQHASTGNADYDRQRTQHFESHGWTVLRFWNDDVLS
FT                   DIDNVCEHIVRVIGKGAFK"
FT   gene            complement(614355..614594)
FT                   /locus_tag="NGR_c05600"
FT   ncRNA           complement(614355..614594)
FT                   /locus_tag="NGR_c05600"
FT                   /product="RNA component of SRP"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            614565..618026
FT                   /locus_tag="NGR_c05610"
FT   CDS_pept        614565..618026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05610"
FT                   /product="chromosome segregation protein SMC"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05610"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24356"
FT                   /db_xref="GOA:C3MHM8"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHM8"
FT                   /protein_id="ACP24356.1"
FT                   /translation="MKFNKLRLLGFKSFVEPTEFIIERGLTGVVGPNGCGKSNLVEALR
FT                   WVMGENSYKNMRASGMDDVIFSGSGNRPARNTAEVGLYLDNSDRTAPAAFNDSDEIQVT
FT                   RRIEREQGSVYRINGKEARAKDVQLLFADASTGARSPSMVGQGRIGELIAAKPQARRQL
FT                   LEEAAGISGLHSRRHEAELRLKAAETNLERLDDVTSQLESQIESLKRQSRQANRFKMLS
FT                   AEIRRHEAILLHIRWVQAKEAESEAASQLNQITALVAEKAQAQMEAAKHQAIASLKLPE
FT                   LRENEAKLAAALQRLQIARAQLEEDAGRILRRRDELQRRLSQLAEDIAREERLVADNSG
FT                   ILSRLDEEEEELKEVLAEADDRAAEAREKLVEAGEKLSDSEADLARLTAERAEAQAARN
FT                   QLDRTLRDLSERQARLARQLSDQARDLEALDRQMAALPDPHEKQEQVEAAEAALEEAEA
FT                   VVVAVEESLAEARAEEAATRPPVDQARALLNGIETEARTIRRMLEASGASDYPAVVEDM
FT                   QVERGFETALGAALGDDLDSPLEQAAASHWRMPGDDADDPALPRGALPLSDYVSAPEAL
FT                   GRTLRQIGIVESETEAERLLPLLKSGQRLVTKEGAVWRWDGHVTGSEAPSAAALRLAQK
FT                   NRLSELEAEAEDAAGALRQAEADLAAAGARIRAEDERLRLSRDAQRMITRQLAEARDAL
FT                   AAAERASGDLARRRAVLAETKLQLEGQVEEAAEQIEAANDALAEAPDLAELELRLRART
FT                   ADVAADRAAVAEARATHDGLARETEARLRRLSAIAGERETWRARASSAEEHIATLRDRE
FT                   AEAREEVEELIDAPDEFEDKRRALMNELQKAETARRQAADILAEAETRQREADRLAATA
FT                   LSELAEAREKRGRAEERLVSARERRVEIEARILEALSCPPHEAMRLTGLAADAALPDMR
FT                   AIERELERLKIERERLGAVNLRADEEQKELSERLAALLKERDDVIEAIRKLRSAIQNLN
FT                   REGRERLIAAFDVVNVQFQRLFTHLFGGGTAELQLIESDDPLEAGLEILARPPGKKPQT
FT                   MTLLSGGEQALTAMALIFAVFLTNPAPICVLDEVDAPLDDHNVERYCNLMDEMAASTET
FT                   RFIIITHNPITMARMNRLFGVTMAEQGVSQLVSVDLQTAERMREAV"
FT   gene            618177..620867
FT                   /gene="ppdK"
FT                   /locus_tag="NGR_c05620"
FT   CDS_pept        618177..620867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdK"
FT                   /locus_tag="NGR_c05620"
FT                   /product="pyruvate, phosphate dikinase (pyruvate,
FT                   orthophosphatedikinase) PpdK"
FT                   /EC_number="2.7.9.1"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05620"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24357"
FT                   /db_xref="GOA:C3MHM9"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHM9"
FT                   /protein_id="ACP24357.1"
FT                   /translation="MTKWVYTFGGGKAEGSAGDRNRLGGKGANLAEMCNLGLPVPPGLT
FT                   IVTDACNSYFDNELTMPEGLREQVREGIARMEEITGRAFGDTSHPLLLSVRSGARASMP
FT                   GMMDTVLNLGLNDQSVHALGHDAGDARFAWDSYRRFIQMYGDVVLGVDHEIFEEILEEE
FT                   KARLGHEQDPELSAVEWQHVISRYKEAIEEVLGEPFPQDPEVQLWGAIGAVFSSWMNPR
FT                   AITYRHLHGIPAAWGTAVNVQAMVFGNLGNSSATGVAFTRNPSTGAKELYGEFLVNAQG
FT                   EDVVAGIRTPQNITEAARIASGSDKPSLEKLMPEGFAEFETICQTLERHYRDMQDLEFT
FT                   IERGTLWMLQTRSGKRTAKAALKIAVDMAEEGLISKEEAVARIDPASLDQLLHPTIDPH
FT                   ARRDIIGSGLPASPGAATGEMVFTSEEAVQAVKEGRKVILVRVETSPEDIHGMHAAEGI
FT                   LTTRGGMTSHAAVVARGMGTPCVSGAGNIRVDQRAELLITASVTLKKGDVITIDGSSGQ
FT                   VLKGEIAMLQPELSGDFGKIMQWADQSRRMTVRTNAETPADARAARSFGAEGIGLCRTE
FT                   HMFFEDDRINVMREMILAEDEEGRRAALAKLLPMQRSDFVELFSIMHGLPVTIRLLDPP
FT                   LHEFLPKTDEEIAEVAGVLSLDPAHLRQRVDALHEFNPMLGHRGCRLAISHPEIAEMQA
FT                   RAIFEAAVEAARVTGAPVVPEIMVPLVGLRAELDYVKERIDAVAKEVIGEAGIGIDYLV
FT                   GTMIELPRAALRADVIAEAADFFSFGTNDLTQTTFGISRDDAAQFLATYQQKGIIEQDP
FT                   FVSLDFDGVGELIQLAAERGRRTKNGLKLGICGEHGGDPASIRFCEEAGLDYVSCSPFR
FT                   VPIARLAAAQAAINGNGKTEALAAS"
FT   gene            complement(620916..621161)
FT                   /locus_tag="NGR_c05630"
FT   CDS_pept        complement(620916..621161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05630"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05630"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24358"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHN0"
FT                   /protein_id="ACP24358.1"
FT                   /translation="MTMMTTRLLTLAAAGLVLAGCQTVTPQERRARDETTCASYGFRRG
FT                   TDSFATCLQRIELDRRAEARAFRYDNDFLMRRPYYW"
FT   gene            complement(621310..621699)
FT                   /locus_tag="NGR_c05640"
FT   CDS_pept        complement(621310..621699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05640"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05640"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24359"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHN1"
FT                   /protein_id="ACP24359.1"
FT                   /translation="MTASETRSEIAVPAPPPSGGDVALPMALLELELSLDRFSGNRDDF
FT                   SAFVRTVADDIGGELLFDLPASGLVDNCLTIAVLRHGQAGGQAPAILFVCLDADGSTIR
FT                   VEQPSERTAGLASFAEAFVGVLERI"
FT   gene            622025..622933
FT                   /locus_tag="NGR_c05650"
FT   CDS_pept        622025..622933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05650"
FT                   /product="putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05650"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24360"
FT                   /db_xref="GOA:C3MHN2"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHN2"
FT                   /protein_id="ACP24360.1"
FT                   /translation="MMVRYERPYSHAAHWARRLARIGFVIFALSLAAHRFGPLTTPHFL
FT                   ALAGCAVAFALLAVLLATVGLTRLWKVAAIGGTASVSALFYAALPLGFFLHGAAQYLAR
FT                   PAIYDVSTDPVTPPPWIKAPVAEESWITRRPIVTPEDREAQIAAYPGLTGRRYDGALDR
FT                   VFQSVRKVVEERRIATTAELGVENARADLEDLAVGPGAGADTNREPEAIPVPATRPAPD
FT                   IEAGIPGRDASDIVLQGEWRTLIAGFRFDVLIRLREEAETTLVDLRVASRYGQHDLGMG
FT                   AKFAEEFLRALDAELLGIAGD"
FT   gene            complement(622941..623852)
FT                   /locus_tag="NGR_c05660"
FT   CDS_pept        complement(622941..623852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05660"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05660"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24361"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041516"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHN3"
FT                   /protein_id="ACP24361.1"
FT                   /translation="MQGPDFDLDFKPAHGEKVTVAEGVERITVNNPGPFTFHGTNSYIV
FT                   GRHSVAVIDPGPEDEAHFQGLMAALAGREVTHIAVSHTHRDHSPLVRRLKEATGAVVVG
FT                   EGPHRAARPLHAGETNPFAESSDMEFVPDVALRDGARIEGDGWSLTAIATPGHTANHMA
FT                   FGLDGTGILFSADHVMAWATSIVAPPDGAMADYMASLDKLLSRDDRLYLPGHGGPVSEP
FT                   PAFLRALKAHRKMRERAVLERLRAGDRNIPDMVKVIYASTDPRLHGAAALSVLAHIEDL
FT                   IEQGRIETDGPPSLLGEYRLVT"
FT   gene            complement(623864..624160)
FT                   /locus_tag="NGR_c05670"
FT   CDS_pept        complement(623864..624160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05670"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24362"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHN4"
FT                   /protein_id="ACP24362.1"
FT                   /translation="MTKFRARPPAVPTVLVDDAVVRIIRWDFEPGADTGHHVHGLGYVV
FT                   VPMTDCQFLVEEEEGSRRIDVAKGAAYRRDAGVAHNVVNAGSEPMSFVEIEYK"
FT   gene            624384..624458
FT                   /gene="trnQ2"
FT                   /locus_tag="NGR_c05680"
FT                   /note="tRNA-Gln2"
FT   tRNA            624384..624458
FT                   /gene="trnQ2"
FT                   /locus_tag="NGR_c05680"
FT                   /product="tRNA-Gln"
FT                   /note="codon recognized: CAA"
FT   gene            complement(624613..625893)
FT                   /locus_tag="NGR_c05690"
FT   CDS_pept        complement(624613..625893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05690"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05690"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24363"
FT                   /db_xref="InterPro:IPR016883"
FT                   /db_xref="InterPro:IPR019282"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHN5"
FT                   /protein_id="ACP24363.1"
FT                   /translation="MPTEQDLGRLQFTTLLYYLQCTNPDNGLVRDKTEPNAPASIAAIG
FT                   MALATIPVVVERGVIIRKFAAKIARKRLEFLLGCPQGPEPDASGYKGFFYHFLDIETGR
FT                   RVWECELSTIDSAFLFAGALTAAAYFDGEDADEAKIRMLANALYERADWNWACDHGLTL
FT                   THGWRPESGFIPYRWRGYDEGLLLYILGLGSPTHPLPPEAYAAYTESYEWRNIYGRELL
FT                   YSGPLFTHQLSHMWIDFRGIRDAFMRDRDTDYFQNSRQATYVQQEYAIRNPMNFRGYGE
FT                   HCWGFTACDGPGWTKKQLDGVEREFFDYIARGAPFGPDDGTVSPWVVVASLPFAPEIVI
FT                   PTVRNFAQMNLGMTHLYGFKPSFNQTYAVEGNDAGWWVSPYHFGIDQGPVVLMIENFRT
FT                   GLLWNIMRRSQPIVTGLRRAGFTGGWL"
FT   gene            complement(626108..628915)
FT                   /locus_tag="NGR_c05700"
FT   CDS_pept        complement(626108..628915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05700"
FT                   /product="phosphoketolase 1"
FT                   /EC_number="4.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05700"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24364"
FT                   /db_xref="GOA:C3MHN6"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR023962"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHN6"
FT                   /protein_id="ACP24364.1"
FT                   /translation="MFFPIRFYRSRRQRECSHSSRESGASTRPVPGSFYVPLPAPPQIR
FT                   RTISGTPGGVRSHSDQAALQLSRFFCASGRFCAKLGHRSYAQHFQMQDRPNTGKISSVS
FT                   ATESRLCKEASMTSLETAKGKKSAANEILATPLSADDLRLMDAYWRASNYLSVGQIYLL
FT                   DNPLLREPLKREHVKPRLLGHWGTSPGLNMLYVHLNRVIRRDDLEMIYIIGPGHGGPSL
FT                   VGHAYLEGTYSEFYPNISQDAEGMQRLFKQFSFPGGIPSHVAPETPGSIHEGGELGYAL
FT                   SHAYGAAFDNPDLIVACVVGDGEAETGPLATGWQGNKFLNPARDGCVLPILHLNGYKIA
FT                   NPCFLARIPEDELRKFFEGMGYRPYFVEGSDPEAVHQTLAGVLDTAVAEIRQIWDDARS
FT                   NGNLKRPAWPMIVFRTPKGWTCPPEIDGKKCEDYWRSHQVPMGEMDRPEHIRILEQWMK
FT                   SYRPEELFDESGRLKSEIASLAPSGRRRMSDNPHANGGLLLRDLKMPDFRDYAVEVNGH
FT                   GAPVAESARMMGMFLRDVMKANLESRNFRLFSPDENNSNRWQDVLAVTDRCYMAEIYPE
FT                   DDHLSPDGRVMEVLSEHQCQGWLEGYLLTGRHGFFSCYEAFIHIIDSMFNQHAKWLKVC
FT                   NEIPWRRPIGSLNYFLSSHVWRQDHNGFSHQDPGFIDHVVNKKADVIRVYLPPDANTLL
FT                   CVTDHCLRSRNYVNVVVAGKQPAPQWLTMSEAIRHCAMGLSIWDWASSDQGSEPDVVMA
FT                   CCGDVPTLETLAAVQLLREHLPELKVRVVNVVNLMKLQPAEEHPHGLSDRDFDGFFTRD
FT                   KPIIFAFHGYPWLIHRLTYRRTNHANLHVRGYKEEGTTTTPFDMVVLNELDRFHLVGDV
FT                   IDRLPQLGARAAYFKQAIQAKLIEHRQHIEQYGDDMPQISGWKWGAKSTTPPARPRTST
FT                   EGDNV"
FT   gene            628990..629166
FT                   /locus_tag="NGR_c05710"
FT   CDS_pept        628990..629166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05710"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05710"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24365"
FT                   /db_xref="InterPro:IPR010879"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHN7"
FT                   /protein_id="ACP24365.1"
FT                   /translation="MAHKFEIFKDKAGEYRVRFKYNNEVMFASEGYAGKASAQNAIESI
FT                   KKNGPDAPVEDNT"
FT   gene            complement(629237..629650)
FT                   /locus_tag="NGR_c05720"
FT   CDS_pept        complement(629237..629650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05720"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24366"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHN8"
FT                   /protein_id="ACP24366.1"
FT                   /translation="MNFRMMTAAGLVLALAGCTTTTGVARNAVEKRWLGQPAGTYFAQF
FT                   GPPLSDVETGGDTVYSWKGGYKTRRIPAEYEKTADGKRGKRISAARTEYLSCAVQLTVS
FT                   SDYVIRSIRIAGDRKRPTGPSWCEEFLGGAKAE"
FT   gene            629939..630015
FT                   /gene="trnP1"
FT                   /locus_tag="NGR_c05730"
FT                   /note="tRNA-Pro1"
FT   tRNA            629939..630015
FT                   /gene="trnP1"
FT                   /locus_tag="NGR_c05730"
FT                   /product="tRNA-Pro"
FT                   /note="codon recognized: CCG"
FT   gene            complement(630053..630334)
FT                   /locus_tag="NGR_c05740"
FT   CDS_pept        complement(630053..630334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05740"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24367"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHN9"
FT                   /protein_id="ACP24367.1"
FT                   /translation="MKPTVRGEDGHRCASCCRGGRDLRSYRTERSNSRSTSAKLSTSRI
FT                   SEAAKENCRRNDWELKPAGETKWQFKTPKQRFCQNFCQIFEREFLSAQ"
FT   gene            630425..630739
FT                   /locus_tag="NGR_c05750"
FT   CDS_pept        630425..630739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05750"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05750"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24368"
FT                   /db_xref="GOA:C3MHP0"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHP0"
FT                   /protein_id="ACP24368.1"
FT                   /translation="MANFGAPAHTAALGNAAGMMIIAAGALGLANAVGDGLRAAKEARY
FT                   QARYNDALDTAISHAEQMEALARTAMELLAELEGDNKRLRAACRQRQEVIDLLKARGRV
FT                   "
FT   gene            630736..630924
FT                   /locus_tag="NGR_c05760"
FT   CDS_pept        630736..630924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05760"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24369"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHP1"
FT                   /protein_id="ACP24369.1"
FT                   /translation="MKPDLTDEQWRRMKEEFGDVAVENPGMLADLLDMLTSKKSERTRT
FT                   RNEKPALSARYLASLNC"
FT   gene            complement(630900..631451)
FT                   /locus_tag="NGR_c05770"
FT   CDS_pept        complement(630900..631451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05770"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05770"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24370"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHP2"
FT                   /protein_id="ACP24370.1"
FT                   /translation="MLKVIANALACLWRGALGILNWAEQFLRWPFSIIFGSGGGGMPSP
FT                   EYKPDVSSAQLLDEFDEARRRQAAVHDLDRDGISTVTKYASALPKARPTIDLGGLNKDI
FT                   RATLLTMDDNELKALSKAGIGAIRKFIAGADHGVHGVPVVRSVEISEAPKEMTEHEQVL
FT                   WKVRSRMLKSENGQQFKLAR"
FT   gene            631539..631787
FT                   /locus_tag="NGR_c05780"
FT   CDS_pept        631539..631787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05780"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05780"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24371"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHP3"
FT                   /protein_id="ACP24371.1"
FT                   /translation="MHRQKSWICGTASGAQHRAGRASSCGLGPEYLTCRLALAMNSNER
FT                   FSHFGGFVLSGKPEVEAHNTKIHPECGCNLYTNFRFR"
FT   gene            631821..633266
FT                   /locus_tag="NGR_c05790"
FT   CDS_pept        631821..633266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05790"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05790"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24372"
FT                   /db_xref="GOA:C3MI24"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI24"
FT                   /protein_id="ACP24372.1"
FT                   /translation="MDIVFTAGIFARDLVLALASLLKQPPAPGLFSLFLVILLVIATLW
FT                   FWAVVRRRVGLLRRATKLVRKSRGPEEFRERFQETYDELTSWSGADAGRLADTWDEFRE
FT                   TTIESQGQTGIRNAIRPSVFFNLEEMGFSVSGWRVVPSLFVSVGLAATFLGLIAALQET
FT                   GNSLSAGGDQAAVMKALTQLLTVASAKFIMSLTGLLCSIVFTVVMRVRSSGLEQEMRTL
FT                   THAIETRMSFVSLEDLAEKQLKAIVEQRDHMQKLNHELIAAISEPLQKAAASGINHVDE
FT                   MVQSLAGSLTQGLVGAMSATSERLEAASGRLEGLAATLSGAAQEFSQAAERTAVGLDGA
FT                   ARRLELVSDNLARAGNGLAQAAVPVAESANKTAEATQQIASSSINMVESARQTMSSERE
FT                   MVVAAANSIREHIKSFETRAAAYDGQLAAAFRTFTEQISRSIGEVENHANNVHGQYTEA
FT                   LSTLQGVIENAKAFTPESARPSA"
FT   gene            633263..634192
FT                   /locus_tag="NGR_c05800"
FT   CDS_pept        633263..634192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05800"
FT                   /product="OmpA/MotB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05800"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24373"
FT                   /db_xref="GOA:C3MI25"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI25"
FT                   /protein_id="ACP24373.1"
FT                   /translation="MRGRGGARRQEEEEESVFISMADMTISFLFILMILLAFFASQFNV
FT                   SDTVPRPLYDSLKDEKDRIQRDIDAIAEIVEANGRPVVTATREMKDELERLRKLLNTPE
FT                   KANKMEVYNSAVADARKNLLTSLKSEINSRIPGVNVAVSANYDALQFAGDGLFDSGKEV
FT                   PTTVGAVRMRQIAEVLDQNLGCYSLGSRRAFTENCNPAFALIDSLQVEGHTDSVGSEVL
FT                   NMDLSAKRAASIYALMIEQKPDLVLYQNRDEQPVLSVAGFGKGRPIQQNETESGRDANR
FT                   RIDLRFIMVVPSKETDIADIRRALSGEP"
FT   gene            634194..635507
FT                   /locus_tag="NGR_c05810"
FT   CDS_pept        634194..635507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05810"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05810"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24374"
FT                   /db_xref="InterPro:IPR028943"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI26"
FT                   /protein_id="ACP24374.1"
FT                   /translation="MSLLETLRAMPHRKKFEGKSIEGLSQAVQAVFQAFPEFSRVSPAT
FT                   LEQMKAKIAAAVRDWEWGSVTVGEVGMLASAAFGRAEELDTQTLSFVRREVQATTNPVL
FT                   LDAAAEGYFAGWSRGGQLTRWLASIMQERSSHLSKRWQSVFVSIPQALDANHAPEHLAE
FT                   RMVMEPDPYRWLAGAGVASPHSGNLMQELHQAWLRTLPEIKTDAQVAHVFRWILPEGRA
FT                   RASDKMAASAIEKLLSPWLHKMPEQEYRKALLDRITDAYGDPRNKRPEFWSLVSAPCRG
FT                   VLVRWLAGASMDALLSVITKSTANHMWPPRHDFWKGLFNRGLVDEAWVALSPAAAAIAQ
FT                   DMFAKSVNAASMAAGRQTSKARKDTCLLVMRIGRYIVVEGSHDYRVHMFSDADSRAPKL
FT                   YQASYDAEALILGAGHPDTRIHDQPGHWKRWVEERVVR"
FT   gene            635504..638722
FT                   /locus_tag="NGR_c05820"
FT   CDS_pept        635504..638722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05820"
FT                   /product="superfamily II DNA/RNA helicase and SNF2
FT                   family-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05820"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24375"
FT                   /db_xref="GOA:C3MI27"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI27"
FT                   /protein_id="ACP24375.1"
FT                   /translation="MIKFDFRADSQAAYVTVAPEKRGWLAAFRRREAVDLRALTKAERA
FT                   TALAVARLRHLDPLGELHQIAENGLVIRHPLVAQLDSNTASALGLPRLMTGYVFKAKLA
FT                   GTVGSSDFGIDWWWEKNGRTVALPLQGAFLGSAAQMMRLPSQIYSAIEQANALKERSSV
FT                   TDHWLELGKFRRLFDASDEPASRENLEGFLRNLSVVTCDSVGIAFDAEDETKFFPLPFV
FT                   GSPEPDPDRDTADVAALKGRELNEFRDGAIRRGAQPAYRVADGKFLIVDRSAAPVLDAI
FT                   ARNAKADEAGRRAFIADAGRIIQSAIERQMEDDGRITALMSPAARAERVEQETSRVWIE
FT                   TTEWVSRVLGVAKWQVTEIEGMQSSGTKWLNSSIDAELADRLSQIEDEQLAEVVEALRT
FT                   AIAEHTPLITHEVGDIPAIAEVLEALSRRLAEYLRQKPIDAPSVSLDAYLPVTHDNFWE
FT                   VDFKAAVRPRGNEAEFKFPEAVRTALQPHQLTSLKWQVAAWQAGIPGVLNADEQGLGKT
FT                   LQTLSFVAWLRAEMDAGAVPHRPFLVVAPTSLLLNWEAEIDRHLSAQALGIPVRLYGSH
FT                   LAEFKKEGLSGQDIREGEALLDLDKIRSLENGAPVVITTYQTLANFAISLMDLQCAVAI
FT                   FDEIQFVKNPVTMRAKAAKSLNADFRIGLTGTPIENATKDLWALMDQLFPGALGALAQF
FT                   KRVFGLPTEENMSALHHALFSGQHERPPLALRRLKTDAAPGLPTKVRILHPREMSEPQM
FT                   LRYDEARRKGGMMLALLHHIRRISLHPGLLEGETTEEFSASAARVDAAMDILRHIKSKG
FT                   ERALVFVENRDVQAWFAEVVRLEFNLDTVMIINGDTTIDARKEITDRFQRHLTNDGGFD
FT                   VLVLGPRAAGTGLTLTAANHVIHLSRWWNPAVEEQCNDRTHRIGQTKPVTVHIPLAVHT
FT                   RLGAGSFDCLLQRLMKRKRTIADRVLWPAEATESETRMLYDAVVEASDVEVGSEALELD
FT                   GVLEGRTDLTAEMLDGNAIRIRPRRGGASIVVSSGRTVPSSSIRSDTDAAVVSMQVHGV
FT                   GKEMPVPHSRLTTGTLWPEFVLPE"
FT   gene            complement(638801..639709)
FT                   /locus_tag="NGR_c05830"
FT   CDS_pept        complement(638801..639709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05830"
FT                   /product="superfamily I DNA and RNA helicases and
FT                   helicasesubunits-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05830"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24376"
FT                   /db_xref="GOA:C3MI28"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI28"
FT                   /protein_id="ACP24376.1"
FT                   /translation="MVETTGPRKNALEHEGAALGRLHARSNNRKALAYWLGFLKGILAS
FT                   NKVETAEYAPLAVEAQNFLSLLHDPDALELIEDLRIWKNEPNEIYEIVENIVAMRSRDF
FT                   VVESEKDEINELYGFCAGIACDNRICLEEIESLLTKLESYPRVQGDRRVLNLKAAAQRS
FT                   IADGRITAEESDDICTWITHLVGDSATDTGIATFGNVGVLEGALEDHNDIVFDQRMFVL
FT                   TGKFTLGPRKAIHGMIADRGGDFKSSVCRNTNYLCVAAEASRDWRHSHEGLKIMKAIEL
FT                   RAEGRGPELVHEGILTRALSR"
FT   gene            complement(639745..640989)
FT                   /locus_tag="NGR_c05840"
FT   CDS_pept        complement(639745..640989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05840"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05840"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24377"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI29"
FT                   /protein_id="ACP24377.1"
FT                   /translation="MVGILPSWRPDIGGTARRKSRIGRPYMICTLIKEGKKVGITANSH
FT                   KVIRNLIDKVIEVARESDAKVQAGQKISSKTENTDDIHFFTDNGEAVTAITSGEVQVLG
FT                   GTAFFWAREDAAGTIDVLFVDEAAQMSLANVLSVSQAGPTLVLLGDPQQLEQPTQGSHP
FT                   DGTDVSALDHLLCGHKTILPEQGLFLEVTWRLHPDITAFNSELFYEGKLQSEADCHRQS
FT                   TTSTGPFTGTGLRYVPVAHFGNQSRSLEEAAAVERIVETLLGSGVHWTDRKGVSRPLAL
FT                   EDIIIIAPYNAHVFEIQKRLPEAHVGTVDKFQGQEAPIAIYSMATSTHADAPRGMEFLY
FT                   SSNRLNVAISRAKCMAILVASPDLFETECKTPRQMQLANAFCRYLEMARLVELQATPSA
FT                   SSTLSESGVRCVSDF"
FT   gene            complement(640908..642362)
FT                   /locus_tag="NGR_c05850"
FT   CDS_pept        complement(640908..642362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05850"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24378"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI30"
FT                   /protein_id="ACP24378.1"
FT                   /translation="MTHAENDRSAALKIRGMTYPLTLQLSLYADLLRVMQGIAPENVYV
FT                   VVPWANFVPQTFRVADYGAFFRKARRAAEEATGAGSGEHYPEPTEHCDICRWADACQTR
FT                   WRKDDHLSLVANISKSQIAELRAHAVSTTKALAQLPSPFPWKPDRGSAASFEKTRAQAH
FT                   IQVSAREAGELLYDLLEVVPDTGLCRLPEPSLGDIFFDIEGDPFIGEHGLEYLFGYHYR
FT                   NEAGDYVRLANWAFDRNTEKAIFERFMDFVTSRREQFPDLHIYHYAPYEPATLKRLMGR
FT                   YATRESEVDRLLRGNVLVDLYTVVRNAVRASVESYSIKKLEAFYGFVRATPLREANVAL
FT                   TALQVALQVNDVVSVSDEIKAVVATYNDDDCRSTEALRDWLEQLRTEIIASGTAVERPA
FT                   PEKDEPSEDLSESEARVAALIGALTYNVPVDVAERTAAEHGKWILAYCLDWHRREAKSN
FT                   WWEYFRLGDLTSEELLDEKAGLGGPI"
FT   gene            642375..642761
FT                   /locus_tag="NGR_c05860"
FT   CDS_pept        642375..642761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05860"
FT                   /product="putative transposase number 1 for insertion
FT                   sequence NGRIS-11a"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05860"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24379"
FT                   /db_xref="GOA:C3MI31"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI31"
FT                   /protein_id="ACP24379.1"
FT                   /translation="MSDSVNHHRTFEVLTAEPVRSRRKPRHWSDEEKAQLVAEALSPGA
FT                   NVSAIARSQGLDPSQLYAWRRKALSSGMVAPLTEGPSAPVKFTRFEAVSSSMVEIVVGD
FT                   VVVRAGGDVDADHLAKILRVVRTA"
FT   gene            642758..643102
FT                   /locus_tag="NGR_c05870"
FT   CDS_pept        642758..643102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05870"
FT                   /product="putative transposase number 2 for insertion
FT                   sequence NGRIS-11a"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05870"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24380"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI32"
FT                   /protein_id="ACP24380.1"
FT                   /translation="MIASGVVVYVSCQPVDFRKGAASLMALVRDGGLDPFNGSLYVFRS
FT                   KRADRVRIVWWDGSGVCLYSKTLEEQGFCWPGISAARMRLDHPQLMALLAGLDWKKIRP
FT                   AKIRRPLLTG"
FT   gene            643160..644797
FT                   /locus_tag="NGR_c05880"
FT   CDS_pept        643160..644797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05880"
FT                   /product="putative transposase number 3 for insertion
FT                   sequence NGRIS-11a"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05880"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24381"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI33"
FT                   /protein_id="ACP24381.1"
FT                   /translation="MCSIASMDLPVSDLPDDVDALKAMILAMAREQAANETRLAAAAAE
FT                   VERLKAVEESANERIANLTAILKVLQRTQHGKRSERLRLAVNDEQVSFAFEEVETGLAA
FT                   IQSELDRAAGDKPKRAPRPRKGFAAHLERIEEVIEPEIPADCAGLEKVLIGEDRSERLD
FT                   VVPPKFRVIVTRRPKYAFRGRDGVAQALAPAHLIESGLPTERLLAYIAVSKYADGLPLY
FT                   RQEAIYLRDGVEVSRSLMAQWMGHLGFELQMVADYILERVKEGERVFADETSLPTLAPG
FT                   SGKTTKAWLWAYARDDRPYGGTSPPMVAYRFEDSRGGDCVARHLAGFSGILQVDGYSAY
FT                   TSLAKTRAKTGSNEPIQLAGCWAHLRRKFYDLHISGVSQAATESIVAMTELWKLEDEVR
FT                   GKNAESRAARRHEESATIVASLFELWEKELGKVSGKSKTAEAIRYAFTRREALECFLTD
FT                   GRIEIDSNIVERAIRPQTITRKNSLFAGSEGGGRTWATVATLLQTAKMNSVDPLDWLSQ
FT                   TLTRIAQGWPASEIEALMPWNFKPDVIG"
FT   gene            644960..645283
FT                   /locus_tag="NGR_c05890"
FT   CDS_pept        644960..645283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05890"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05890"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24382"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI34"
FT                   /protein_id="ACP24382.1"
FT                   /translation="MFPGTHRFQGCANGFVIDFYAWDRNCLQSPSLEMVEEFGFVLQPT
FT                   FLEDLQQGIPSSGFGQRALGDLEIKIRQMAAVEMANQIMRAEDDLSADSLHVSTVSGIM
FT                   RAV"
FT   gene            645574..645840
FT                   /locus_tag="NGR_c05900"
FT   CDS_pept        645574..645840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05900"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24383"
FT                   /db_xref="GOA:C3MI35"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI35"
FT                   /protein_id="ACP24383.1"
FT                   /translation="MPVEALVLHGVSRQHAVPSAGKDGFIARLDQIRDKSAVALSRKGA
FT                   VFTRPALVAEVEYSAWTEDGKLRHPSIKGLRERADDTIVFEIA"
FT   gene            complement(645933..647006)
FT                   /locus_tag="NGR_c05910"
FT   CDS_pept        complement(645933..647006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05910"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05910"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24384"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI36"
FT                   /protein_id="ACP24384.1"
FT                   /translation="MPQLWYKCATSQTDCILAVMATDSHDLSTESELLTSLPDIAVSVQ
FT                   GFGSQDTAQALGNGVIHLLHEVGRFIDISSLDGVTIAVDYDAALRDLDRGIEGLRPEER
FT                   TKDGILTGVGKAILVKRADDVKTHLVFAAEALSCLALKEADSGLFYLALALIAHECAHV
FT                   EEHARRNRQFPGTLLNEESLGFVPACLRQFSEAFWCEYAVCRASANFAPNEGDGFREAL
FT                   KLRLEPARREAREAIKAYRTHGDALRVFNEVGLAVIEPLRMASYLFGHLDGFSGDLTDV
FT                   TIELPTNDQAFVAGITELVSQLRDLWDRRDHWESHDDMLVLGETAFDVLRLCGVDVQPS
FT                   ANGQAHIAVPITLDTIP"
FT   gene            647440..647865
FT                   /locus_tag="NGR_c05920"
FT   CDS_pept        647440..647865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05920"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24385"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI37"
FT                   /protein_id="ACP24385.1"
FT                   /translation="MFVLPLAGIVIGGAYGWATVPPEDTISASFPICASGARTTCVVDG
FT                   DTFWLDGIKYRISDIDTPEISEPKCAWERELGQRAKYRLQSLLNGGSFGLKAGLRDADK
FT                   YGRKLREVYRGGRSLGAQLIDEGLAHRWLGFKQSWCG"
FT   gene            648777..649757
FT                   /locus_tag="NGR_c05930"
FT   CDS_pept        648777..649757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05930"
FT                   /product="transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05930"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24386"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI38"
FT                   /protein_id="ACP24386.1"
FT                   /translation="MLNKDTLNPAPHVATSKPIPLQRQSSVRRTMEIVLDTWNFLILRE
FT                   AYFGVRRFDKFQQRLGIPRQTLSSRLSALVSNEIMSVGRRPNEPGQQYFLTERGKDLFP
FT                   TMLSLMEFGDKWLTGGKEPPLQLVHKSCGCACHPVTVCSECLEPFTAREVAPRDGPGAG
FT                   YAPVDTRPTSRRSSDPTLLERVRPCSVARTLGIIGDRWSFLILREGWFGVRRFEEMREN
FT                   LGIATNILADRLARLVQADVFRKVPYGSSDRFEYRFTEMGLDLYKPMLVMMAWGDRWLA
FT                   EGKPPMRLRHKTCGQDFSAIVVCSECRKQITVKDTDYILRYPFNL"
FT   gene            complement(649747..652140)
FT                   /locus_tag="NGR_c05940"
FT   CDS_pept        complement(649747..652140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05940"
FT                   /product="putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05940"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24387"
FT                   /db_xref="GOA:C3MI39"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI39"
FT                   /protein_id="ACP24387.1"
FT                   /translation="MSLHDHSVELRPKLVGKRVKRTEDPRLLAGVGQYVDDMAPAGMLH
FT                   VALRRSDQPHARILNIDVGEAFSVPGVIAIYDATDLENEVRPAIPTSRMPDYYATPIWP
FT                   LARNKVRYVGEPVVAVVAESRYAAEDALEHITIDYEPLPFAIRQVDAVKDDAPLLHEEA
FT                   GTNTIIRREFKRGDVDAAFESAAVTVKGRFRMTRKTAVAMENRSYLAEWDARKQALTLY
FT                   TSSNIPGVIRDVLSGCLDLPGTRLRVVAPDVGGSFGGKGSLYGEEILVCALARKLKRPV
FT                   KFVSDRLEDLSATSQAFDELIEAELAVTEDGMLIGLRADVIGDVGAYSIYPWTAALETV
FT                   QVVSFLPGPYRMEHYRGRIRGVLTPKPPTGPYRGVGRPSSTFAMERLIEMAAGKLGMDP
FT                   VAFRRKNLVNAEEFPYRTASGIIWDKSAFQECLAGACAHVNYPNLLLERDEARRNGRWV
FT                   GIGLASYAELTGIGSRISVAPGMPINTGTETAKIEIDATGAITAAFGIASHGQGLETTL
FT                   AQVIVDELGCKLEDIEVKHGDSALVPMSSGTYASRSAVLGGGAAILAARVVKGKALRAA
FT                   AYLMEQDVKDLDMHDGIVSSRNSNRTMTLKEIASTVYSQMGRIPRDQREDLAASETYDP
FT                   YLGTACSSTHLAMVEVDPETYGVKVLRYVVAEDCGKIINPMIVDGQVQGAVAQGIGAAL
FT                   LEEIVHDDQGQAVAASLADYLVPVATNVPDIGIVHIEADLPNNVGGFRGMGEGGTIGAP
FT                   ATIANAVSDALSHLGVSVETLPVTPERIFRMLQARRDPSAAVTD"
FT   gene            complement(652137..652898)
FT                   /locus_tag="NGR_c05950"
FT   CDS_pept        complement(652137..652898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05950"
FT                   /product="putative beta-lactamase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05950"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24388"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI40"
FT                   /protein_id="ACP24388.1"
FT                   /translation="MKMHFLAGGRLRMRRSVFVPGVGKEETIELPVHATLIRHRQGNVL
FT                   FDTGCNPEAATDPEARWGGLAKVMTPIFDPEQTVVRQLAALGLEAGDIDVVICSHLHPD
FT                   HCGCNQYFGRATILCHEAEVAAAKTDAAENQGYLKPEWDQPQGFQTFGAEHDVFGDGHI
FT                   VLLPMPGHTPGMTVAHVSLRDSGTFVLASDAAPLQANIDAGVAPRNTWNMELAAAALAR
FT                   LKAFRDKGATIVSGHDEAQWQALRKGGEFYE"
FT   gene            complement(652895..653380)
FT                   /locus_tag="NGR_c05960"
FT   CDS_pept        complement(652895..653380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05960"
FT                   /product="carbon monoxide dehydrogenase small chain"
FT                   /EC_number="1.2.99.2"
FT                   /note="COdehydrogenase subunit S; CO-DH S"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05960"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24389"
FT                   /db_xref="GOA:C3MI41"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI41"
FT                   /protein_id="ACP24389.1"
FT                   /translation="MPEKKITLSVSVNGVAHTATVEPRMLLSDFLRHELGLTGTHVGCE
FT                   HGVCGACTVILDGRSARSCLTLAVQAEGVEIETVEGQGSVDRLGRIQEAFRQHHALQCG
FT                   FCTPGFIMAITDMLRHHPLESDEQIREALSGNICRCTGYEHIVNAVRELARERGPLT"
FT   gene            complement(653373..654434)
FT                   /locus_tag="NGR_c05970"
FT   CDS_pept        complement(653373..654434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05970"
FT                   /product="carbon monoxide dehydrogenase medium chain"
FT                   /EC_number="1.2.99.2"
FT                   /note="COdehydrogenase subunit M; CO-DH M"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05970"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24390"
FT                   /db_xref="GOA:C3MI42"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI42"
FT                   /protein_id="ACP24390.1"
FT                   /translation="MLDNPILSLIMQVNFETRHGIGETRRSRDDKAFRDISEPSGAHGP
FT                   TMPESAFPIDGGEMKPAPFEYLAATSAAEAAEALAAANGDGKIIAGGQSLMPMINFRLV
FT                   KPTILIDINRIAGLDRIEKHGERLRIGATVRHRMTATDALVHRHIPILHDAMHHVAHLT
FT                   VRNRGTFCGSVCHADPAAEMPVMTLLLDGTITALSIRGERQIAASDFFVGSLMTALEPD
FT                   EFVTSIDIDTLPPETGWGFEEFSRRHGDFALACVATTLRIVDGVAGDVRFGMMGVGETP
FT                   LRLPDIETLVEGQAISEMLLQDVSETLKGLLHPNTDIHASADYRLHLAGALARRALRDA
FT                   WTRATLRKDGADA"
FT   gene            654489..655295
FT                   /locus_tag="NGR_c05980"
FT   CDS_pept        654489..655295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05980"
FT                   /product="conserved hypothetical protein with CoxG domain"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05980"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24391"
FT                   /db_xref="GOA:C3MI43"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI43"
FT                   /protein_id="ACP24391.1"
FT                   /translation="MDMTGQQHIPASKEEVWSALNDADVLKVCIPGCQELTKSSETEMS
FT                   AVAVIKVGPVKARFQGAVTLSDLDPPNGYRITGEGQGGVAGFAKGVAVVRLEAVEDGTV
FT                   LHYTVDAQIGGKLSQLGGRLIDATAKQMSGQFFKRFAEEIRARQGAGQSLATSTEGDAF
FT                   AQPGPVRQSVAVTSSSESASALPRARAVQVSASPTGTSLSLPVLAAVVFAAVVVATWAL
FT                   HGGLLPSLTPPADGPARISPDLASIVQLIMAAAIGYLFGSRGRRAG"
FT   gene            complement(655357..656334)
FT                   /locus_tag="NGR_c05990"
FT   CDS_pept        complement(655357..656334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c05990"
FT                   /product="putative permease component of ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05990"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24392"
FT                   /db_xref="GOA:C3MI44"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI44"
FT                   /protein_id="ACP24392.1"
FT                   /translation="MNSTTMVSSLEPPRTRRHRTTGGLLLALVALLMICAPLAIYPLFL
FT                   IKILCFALFAAAFNLVLGYAGLLSFGHAAFFGGAAYITAHAAKVWQLPFELAVLAGTAF
FT                   AALLGLAFGTLAIRRHGIYFAMITLALAQMIYFMAVQMPFTGGEDGIQAVPRGYLLGII
FT                   DLRDITAMYYTVLGGTILGLVIIWRTVNSPFGHILSAIRENETRVTSLGLKPERYKLIA
FT                   FTLSAALSGFAGALKAIAFQLASLVDVTWHMSGEVILMTLLGGMGTLIGPIVGASIVVG
FT                   LEHFLSTSGLPITFIIGLFFVVCVMMFRRGVFGELKALLERSKP"
FT   gene            complement(656337..657224)
FT                   /locus_tag="NGR_c06000"
FT   CDS_pept        complement(656337..657224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06000"
FT                   /product="branched-chain amino acid ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06000"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24393"
FT                   /db_xref="GOA:C3MI45"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI45"
FT                   /protein_id="ACP24393.1"
FT                   /translation="MTDIFGVPIAVLLGQLLLGLINGSFYALLSLGLAIIFGMLNVINF
FT                   AHGAFYMLGGFAAWLLLSALGLGYWETLIAAPLMVGALGAVVERLFLKRLYRVDHLYSL
FT                   LLTFGIALMLEGLLRHVYGAAGKPYPIPPSLTGGINLGFMFLPMYRAWVIVASLAVCIA
FT                   TWLAIERTKLGAYLRAATENPGLVQAFGINVPFMLTATYAFCVGLAGFAGALAAPLYQV
FT                   SPGMGSSVIIVVFAVVVIGGMGSIGGAIVTALALGIIEGLTKTFYPAASSIAVFVVMVL
FT                   VILIRPSGLFSREA"
FT   gene            complement(657260..658021)
FT                   /locus_tag="NGR_c06010"
FT   CDS_pept        complement(657260..658021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06010"
FT                   /product="putative ATP-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06010"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24394"
FT                   /db_xref="GOA:C3MI46"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI46"
FT                   /protein_id="ACP24394.1"
FT                   /translation="MPTFPPTAKSARRIWEAAMAEAPLLDVKGLEAWYGESHVLHGIDF
FT                   DVRKGEVVTLIGRNGAGKTTTLRSLIGVVGKRRGACIYKGADLLKVAPHKVARLGIGYV
FT                   PEERGIFSSLTVLENLLFPPAWQAGGMAVDEIYGLFPNLKGRDSTSGTRLSGGEQQMLA
FT                   IGRILRTGADFILLDEPTEGIAPVIIEEIGAALRILKDRGMTIILVEQNLRFAASIADR
FT                   HYVLDQGKVVDEISNNALDANMDRLNRYLGV"
FT   gene            complement(657960..658718)
FT                   /locus_tag="NGR_c06020"
FT   CDS_pept        complement(657960..658718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06020"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06020"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24395"
FT                   /db_xref="GOA:C3MI47"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI47"
FT                   /protein_id="ACP24395.1"
FT                   /translation="MPDSAPIIEARALTRSFSGFIAVKNVDLKIRAGTIHALIGPNGAG
FT                   KSTLFNLLTKFLSPSSGQILFKDRDITQMAPADIARLGLVRSFQISSVFPHLSAHENVR
FT                   VALQAHAKETFAFWKSNATLRRFNEEAARLLDSVGLADRAQTKAAELSYGRKRALELAT
FT                   TLALDPEVLLLDEPMAGMGTEDIGRTAALIRSVGKGRTVLMVEHNLGVVSDLSDRITVL
FT                   RRGEVIAEGSYADVSADSEVRKAYMGGSHG"
FT   gene            658980..660188
FT                   /locus_tag="NGR_c06030"
FT   CDS_pept        658980..660188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06030"
FT                   /product="putative ABC branched-chain amino transporter,
FT                   periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06030"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24396"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI48"
FT                   /protein_id="ACP24396.1"
FT                   /translation="MKNKLMLLSCVAAVGAMTMSAGAQDAAPVRIGVLTDVSGQFSHEA
FT                   GEGSITAVKMAVEDFGGKVLDRPLEVVVADHQNKPEVAVSTAREWYESQGVTMINNLIN
FT                   SGIALAVTQVAKDEDRIAIVNGSGSSRLTNDGCTPNSIHYSYDTYALANGTANQLILQG
FT                   MKNWFFLTADYAFGHALEADATQIVKDNDGEVSGSVRYPIETSDHSAFMLQAQASPAQV
FT                   VAMAGSGTTFINAVKSAAEFGLAASGKTVAGLLVWDTDVHSLGLETAQGMILTNAFYWD
FT                   RDDATRAFSKRFEERVGRPPHMGDAGDYSSTMHYLKAVEAAGTTDAQKVMAKMRETPIN
FT                   DFFAKNGKIREDGRMVHDMYVYQVKTPAESTGEWDILKLVTTISGDDAFRPLSESQCPL
FT                   VKN"
FT   gene            660283..661050
FT                   /locus_tag="NGR_c06040"
FT   CDS_pept        660283..661050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06040"
FT                   /product="3-hydroxybutyryl-CoA dehydratase"
FT                   /EC_number="4.2.1.55"
FT                   /note="crotonase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06040"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24397"
FT                   /db_xref="GOA:C3MI49"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI49"
FT                   /protein_id="ACP24397.1"
FT                   /translation="MSDILVENKGGVAVVTLSRPGHRNAVTYAMWRQLAELFRAFDLDP
FT                   SVRSIILTGAGDDFSAGADISEFDVVRGGLEDSKSYELAVDAAADAIYQVSKPTIAALR
FT                   GYCLGGAAHLAMSCDFRVAENNAVFGIPAARLSIVYGVSATRKLYALVGVTEAKRILFS
FT                   ASRFDAGRALDIGFIDQVAENALAAAHDRAAELAENAPLTISGAKFILNGCARGALDHA
FT                   AAGRLIDEASASEDYIEGRQAFKDKRPPRFLGK"
FT   gene            661130..661885
FT                   /gene="fabG3"
FT                   /locus_tag="NGR_c06050"
FT   CDS_pept        661130..661885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG3"
FT                   /locus_tag="NGR_c06050"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="3-ketoacyl-acyl carrier protein reductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06050"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24398"
FT                   /db_xref="GOA:C3MI50"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI50"
FT                   /protein_id="ACP24398.1"
FT                   /translation="MQTNLNGKVALVTGGGRDVGGDIARSLAAEGAIVAVNYSRSQAEA
FT                   DSVVASIEAAGGKAKAYKADIGENDQVKAMIAAVKADFGTIDVLVNNAGYVKYQRFVDS
FT                   TPEEWKKQIDVCLYGAINCCHAVAPLMIEQNFGRIINLVGDSSRIGEANLALAAAARGG
FT                   TIALGKSLAREFGRNNITVNSVSLGLIETSHSDPEFLEKNREKIVKAYPLRRIGRPDDV
FT                   APMVTFLASEGSSWVTGQVISVNGGFCMV"
FT   gene            661907..663433
FT                   /locus_tag="NGR_c06060"
FT   CDS_pept        661907..663433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06060"
FT                   /product="long-chain-fatty-acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06060"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24399"
FT                   /db_xref="GOA:C3MI51"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI51"
FT                   /protein_id="ACP24399.1"
FT                   /translation="MIHFELIAPVGAILRRNARLYPGKMAFEDRRRSVSYDALDRETED
FT                   LASRLVALGLRKGQAVAIFLPNSVNWVVACLAVVRAGGTAVPVSIEATEAEIAYRISDA
FT                   GCAFLIMPPEKQPVVDTLLQRSDKPPVVIAANEEIGFDASGRTAAFEDDQDIDRPAFIV
FT                   YTSGTTGQPKGVLLSMRSMLWVTAACWAPIAGLNENDIVLNTLPLYHSYALNIAVLSII
FT                   ATGASEYIMEKFSTSQATELLRTGRFTFMPGVPTVFHYFLSACQASGERLLSSVRLCVS
FT                   AGAIMPGTLNSDFEAFFDVPLLDGYGITETSTMVTMNWPGKWRVPGSCGLPVPGLTVRL
FT                   VDPKTGLDVPAGVEGELICKGPNLMQGYHNKPLETEKAVVDGWYHTGDLAKSDLNGFLT
FT                   ITGRLKELIIRGGQNIAPAEVEEAILLLHDTVMDCAVVGMPHSMLGEVPVACIVVKEGQ
FT                   AFDQEDLMRHCKARLSAYKVPDRVYVVAEIPRTGSGKILRVKLRESLPAA"
FT   gene            663459..664619
FT                   /locus_tag="NGR_c06070"
FT   CDS_pept        663459..664619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06070"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="similar to DddB"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06070"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24400"
FT                   /db_xref="GOA:C3MI52"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI52"
FT                   /protein_id="ACP24400.1"
FT                   /translation="MNPFVFSTTGHLVFRPGAAAQIGRLLDRRFGERILFVTDGSLRRL
FT                   GLCEPALASLSGSGIVVTVFDAVEADPSLSTVVAAVEMAKAAGVTGVIGFGGGSSLDVA
FT                   KVVALLCGSGEDIDGAWGVGNAKGPRLPLALVPTTAGTGSEVTPVSIITVGGDEKRGVS
FT                   SPVILPDIAILDAELTLGLPPSITAATGIDAMVHAIEAYASRNANNNPLSRMLARQALQ
FT                   LLGANIEKAVFDGKDRAARGAMLLGSMLAGQAFANSPVAAVHALAYPIGGTFHIPHGLS
FT                   NALVLPHVLRFNAPVAASVYAEIAADAFPDLACEQDAGQRCAAFIERLAELSTRLGLQP
FT                   RLRDVGIGEEHLAGMARDAMKQTRLLVNNPRDVNEADALSIYKAAW"
FT   gene            664619..665062
FT                   /locus_tag="NGR_c06080"
FT   CDS_pept        664619..665062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06080"
FT                   /product="putative thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06080"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24401"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI53"
FT                   /protein_id="ACP24401.1"
FT                   /translation="MMEREGPGKRSDYKVFRTIGTRWSDNDTYGHMNNVVHYSLFDTAV
FT                   NGFLIESGVLDIKGGVEIFLVVETGCRYYAEMTFPDVVTAGIRVAKLGNSSVRYEIGLF
FT                   RNDDETAAAEGFFIHVNIDRLSRRAVPFGHAVRRLLEPLLVTS"
FT   gene            665074..665214
FT                   /locus_tag="NGR_c06090"
FT   CDS_pept        665074..665214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06090"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24402"
FT                   /db_xref="GOA:C3MI54"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI54"
FT                   /protein_id="ACP24402.1"
FT                   /translation="MTMPSEGLISTEVAPFGGMKESGNGREGSKYGMDDYLEIKYMCMG
FT                   I"
FT   gene            665217..665801
FT                   /locus_tag="NGR_c06100"
FT   CDS_pept        665217..665801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06100"
FT                   /product="adenylate kinase"
FT                   /note="ATP-AMP transphosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06100"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24403"
FT                   /db_xref="GOA:C3MI55"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI55"
FT                   /protein_id="ACP24403.1"
FT                   /translation="MVNLVLLGPPGAGKGTQAERLVRDYDLLHISTGDLLRDAIKAQSP
FT                   LGRKAKMAVDEGKLVPDEVVVGLVEERLTDKEPGQGFILDGFPRTIAQAGALERLLESM
FT                   QVPLDHVILFDIPIRLLEERIAKRAEQTRSAGAQPRTDDSPEVLKKRIEEFARATAALS
FT                   PFYEQNGLLRRVDASEDIERVATQIRDFLQP"
FT   gene            complement(665877..666518)
FT                   /locus_tag="NGR_c06110"
FT   CDS_pept        complement(665877..666518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06110"
FT                   /product="putative L-fuculose-phosphate aldolase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06110"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24404"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI56"
FT                   /protein_id="ACP24404.1"
FT                   /translation="MAALSEETRTRDNIVRAGKSIFDRGLTFGSTGNISVKMSDGRMLM
FT                   TPTNASLGSLVPEQLSLFSAEGVHLGGDKPTKEAFLHRCMYCARQHGKAVVHLHSTYSV
FT                   AVSILKDVDEKDVLPPLTAYYVMRVGTLPLVPYFRPGDEKLATAVQEAAATSNAVLMAN
FT                   HGPVVAGRSLEEAQYATEELEETAKLFLMLHGRELRPLSPTQREELTKSI"
FT   gene            complement(666518..667792)
FT                   /locus_tag="NGR_c06120"
FT   CDS_pept        complement(666518..667792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06120"
FT                   /product="paral putative tRNA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06120"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24405"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI57"
FT                   /protein_id="ACP24405.1"
FT                   /translation="MAKNRKLLIGCVADDFTGATDVAGIFAKSGMKTTVLIDVPDEGLE
FT                   VDADAIVVALKTRTIDPSDAVAQSLAALRWLQHRGAAKFYFKYCSTFDSTERGNIGPVL
FT                   DAMLAALGSDFTTACPAFPANARTIYKSNLFVGDIPLSESGMKNHPLTPMTDSNLVRVL
FT                   APQTSHKVAGCYHETVKQGVDAVRAWVSKARADGYGVAVLDAMDDGDLEVIAAAFDDAP
FT                   FLTGASGLAYGLARTMFEGGAAAAREPEPSTLPGGSRAVISGSCSTATNGQVEQMLQDH
FT                   EGFRIDVEQLATGQDVVKEALDWAKGRLGQKPVLFYATAAPDQVKANQAKFGVAEAGTM
FT                   VEGALSKIAKQLVDRGVSELIVAGGETSGAVVKSLGINQLDIGNEIAPGVPWVSSPTAA
FT                   GRISLALKSGNFGAPDFFVQAWDKL"
FT   gene            complement(667797..669275)
FT                   /locus_tag="NGR_c06130"
FT   CDS_pept        complement(667797..669275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06130"
FT                   /product="putative aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06130"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24406"
FT                   /db_xref="GOA:C3MI58"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI58"
FT                   /protein_id="ACP24406.1"
FT                   /translation="MLTYKMLIDGQWADAALGETFETRNPYTGDVWAAIPKGTKEDAER
FT                   AVEAAHKAFTSGTWPKLTASDRGHLLRRLGDLIAENAERLARIEVTDNGKLINEMLFQL
FT                   KYIPQWYHYFGGLADKIEGAVIPIDKPETFNYTRNEPLGVCVGITPWNSPLLLLSYKLA
FT                   PALAAGNTFVAKPSEFTSASTLEFAKLVEQAGFPPGVFNVVTGFGADVGETLTTHKHVA
FT                   KIAFTGSEGTGRKIGELAARNFKKVTLELGGKSPHIVFADAEIDNAVNGVISGIFAATG
FT                   QTCIAGSRLLVESKIHDQVLEKVIALAKTARMGDPLSTSTQVGPVTTPPQLEKILGYID
FT                   IAKGEGAECLLGGARPSNSELGNGWFVEPTIFAGVRNSMRIAQEEVFGPVLAVIPFDTE
FT                   EEAIHIANDTNYGLAAGFWTQDMRRMLRVSAAIQAGTVWVNTYRTISYMSPLGGYKHSG
FT                   IGRENGMASIQNYLQTKSVMISTAESVANPFIMR"
FT   gene            complement(669289..669999)
FT                   /locus_tag="NGR_c06140"
FT   CDS_pept        complement(669289..669999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06140"
FT                   /product="probable haloacid dehalogenase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06140"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24407"
FT                   /db_xref="GOA:C3MI59"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI59"
FT                   /protein_id="ACP24407.1"
FT                   /translation="MADGIKAIVFDTFGTVVDWRGSIISDLASWGVEQGLNVDWADVVD
FT                   RWRDRYNPQKARVRSGELPWTNLDELHFDALKTVFDEMGLPLLDEARMMHINKVWHRLN
FT                   GWPDASRGLHRLKTKFIIGPLSNANVAILVNMAKHADLPWDNVFSCELFQHYKPDPETY
FT                   LGVCKLLYLEPSAVMMCAAHNYDLAAARALGLRAAFIARPNEYGPGQTTDLKAEQDWDY
FT                   VADDLEDLARRLGC"
FT   gene            complement(669999..670325)
FT                   /locus_tag="NGR_c06150"
FT   CDS_pept        complement(669999..670325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06150"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24408"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI60"
FT                   /protein_id="ACP24408.1"
FT                   /translation="MTRPQTDGYVVVVEFLVRGDLLNQFREAMMENAATSLRDEPGCSV
FT                   FDVCQDSEQPERIHLYEVYGSRADFDFHLKSAHFLSFNEASQPWVLEKKVQTFERIAAP
FT                   SGGH"
FT   gene            complement(670322..671437)
FT                   /locus_tag="NGR_c06160"
FT   CDS_pept        complement(670322..671437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06160"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="beta-IPM dehydrogenase; IMDH; 3-IPM-DH"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06160"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24409"
FT                   /db_xref="GOA:C3MI61"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI61"
FT                   /protein_id="ACP24409.1"
FT                   /translation="MTMKNDTLTIAVLPGDGIGREVMPACLELVNAATTMAGAPALAFQ
FT                   THNAGAQYYAESGDALPASTLDACRKSDAILFGAMGWPDIRFPDGTEIIPQLDLRMELG
FT                   LFAGVRPIRWFPGLPRVLTDPRAEQIDFVLVREQTEGLFYARGRGEIRNDEEAYDTMQI
FT                   TRSGTQRVTEFAFDIARQRKRRGKPGNVTCVDKANVFQSMAFFRKVFDEVADRHSDLTK
FT                   DHAYVDALALNMVKKPWTFDVLVTENMFGDILSDLAAGLIGGMGMAPSADIGDKHGLFQ
FT                   PAHGTAPDIAGKGCANPSAMFLSAAMMLDWLAAKFGQPTLADAARLMEGAVEHTLSTKL
FT                   AIPMEYGGNANCAEMTRSVISSLSAARKEVA"
FT   gene            complement(671450..672160)
FT                   /locus_tag="NGR_c06170"
FT   CDS_pept        complement(671450..672160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06170"
FT                   /product="putative HTH-type transcriptional regulator in
FT                   the TAR-I ttuE-ttuC'intergenic region"
FT                   /note="ORFX"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06170"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24410"
FT                   /db_xref="GOA:C3MI62"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI62"
FT                   /protein_id="ACP24410.1"
FT                   /translation="MAAEKAIEVSAEIKDEVAAKTMTATAHLKVRQLILDNKWPPGYQA
FT                   TEQEVASMLGMSRTPVREALMRLQQDGLVSVVPRHGMRVLPVSPSDMKEIYDILTSLES
FT                   TAAELAAARHLTEEQLKGLERATADMDKALERDDLDRWAQADARFHEQLLELSGNKMLK
FT                   SVVLNFIDRAHRVRMLTLKMRPKPVNSTRDHAELVNAIRAGDVEKAGTIHREHRRRAGR
FT                   ELLDLLERLGLNHL"
FT   gene            complement(672171..673040)
FT                   /locus_tag="NGR_c06180"
FT   CDS_pept        complement(672171..673040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06180"
FT                   /product="putative UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06180"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24411"
FT                   /db_xref="GOA:C3MI63"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI63"
FT                   /protein_id="ACP24411.1"
FT                   /translation="MRVLVTGGSGKLGRATIKDLLENGHDVINADTVEPTDALCPFVKV
FT                   DFEDMKVTLEAITGYDWDHNRKTEAVVHLAAIPMPGRVPPADVFRINTMSTYNVFESCR
FT                   LLGIKNVVWASSETLLGIPYTIKPDYFPADEEYESRPETSYSLSKHLGEEMAKQYCRWD
FT                   KDLKIVCLRFSNVMDESEYAAFPDFENDPGSRRFNLWTYIDSRDGAQAIRKSLEWDAKG
FT                   AEVFIIANEDGVMTTPNKTLVERFYPGVPFKREIGPNETLLSIEKAKSVLGYKPEHGWR
FT                   RYVSSMRY"
FT   gene            complement(673071..674051)
FT                   /locus_tag="NGR_c06190"
FT   CDS_pept        complement(673071..674051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06190"
FT                   /product="putative transmembrane component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06190"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24412"
FT                   /db_xref="GOA:C3MI64"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI64"
FT                   /protein_id="ACP24412.1"
FT                   /translation="MSNETTIVKAEPLTATSSKPWYGNWRDYVVYIGFVAIFIVFAILL
FT                   HDRGFLSPNNLLNVLRQTAIIAIMAMAMSFVLSAGEIDLSVGAIAGLTSVVAGMVLMQY
FT                   GLVFGIVAGLCLGLVVGAFNGALTAYLNIPSFLVTLGMMGIARGVGMWVSGTSPVPVID
FT                   DTFTYAFGSGNIGPIPVLVIWVVVLGTVAHLAIRKTPFGRKVMAAGGNPVAALYSGVNV
FT                   RRVKFQVLMITGVAAAIAGMLYAGRLQSGRFQLGEGDELSVIAAVVLGGTSLFGGRGTV
FT                   VGSIVGALLIGIINNGLILGGLEYSQQLIARGMLIILAVAIGRGR"
FT   gene            complement(674041..675639)
FT                   /locus_tag="NGR_c06200"
FT   CDS_pept        complement(674041..675639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06200"
FT                   /product="putative ribose ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06200"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24413"
FT                   /db_xref="GOA:C3MI65"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI65"
FT                   /protein_id="ACP24413.1"
FT                   /translation="MTQPMQTPITDPRDVAAVKMTDIKKSYGGVHALKGVSLTIRPGTI
FT                   HALIGENGAGKSTLLKILQGVVIPTEGSIEVFGEHLTAVSPENSRRLGIGMIFQDLSLI
FT                   PTLTIAQNIFLNREPRRMSLLVDERREIEDAAKIIGELNLNVDPRTRVLELSPGQAQLT
FT                   EIAKAISQKARVLILDEPTSALSAQEVDILFKMLRKLTADGTAIIYVSHRMTEIMTIAD
FT                   EITILRDGQNVTSGNIADFTLDTIVQNMVGKRVTGFEYKPHEIDRGTQPALKVRSLSGK
FT                   HGKPSDVSFDLYRGEVLGIAGLMGAGRTELARVLFGVDAKADGTVELDGKVLEFRSPAE
FT                   AIEAGIVLVPESRHDQGLVIEHTVGHNLSLPQLAQLASGPFLDRRREHDLSSELISRLR
FT                   IKTPDADNKVRNLSGGNQQKIVIAKWLATDPSVVILDEPTAGVDIGSKAEIVELIRSIA
FT                   SGGKSVIVISSEPAELLATSDRILVLSNGRLAREISRSEIDAWATTEGDESQSSMIRVE
FT                   LGLQVAIQKASQNVQ"
FT   gene            complement(675689..676819)
FT                   /locus_tag="NGR_c06210"
FT   CDS_pept        complement(675689..676819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06210"
FT                   /product="ABC transporter sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06210"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24414"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI66"
FT                   /protein_id="ACP24414.1"
FT                   /translation="MSIEISTSIRSLMMVAAVALSAPLAPNAYAIDVTQQIKEIENSPA
FT                   DGPNGEKAVLASDLKLTPEEIEQIKTKNATAAIVMHYTASDWAKAQMAGQKKALDELGI
FT                   KIIATTDAGYKAEQQVADIESVMALKPDIIISVPAEQSATAAAYKKAAAAGIKIVFLDQ
FT                   AAAGMKPGTDYVSLVSSDNRGMGKVAALLMAKALNGKGEIALIPHASDLFATKERVVGF
FT                   KEAIAAFPDIKVVDESGVGGPDFAGESERIASAMLTGHPTLNGLWAVWDVPTEGVLAAA
FT                   RAAGASTDLVITTCDLGVNISLDMAKNGYVKGTGSQRPFGAGYAEGILAGYALLGKEAP
FT                   PYVVLPALAVTRDNLIDAWPQSNGDQAPDILVKAMN"
FT   gene            677028..677753
FT                   /locus_tag="NGR_c06220"
FT   CDS_pept        677028..677753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06220"
FT                   /product="putative dehalogenase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06220"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24415"
FT                   /db_xref="GOA:C3MI67"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI67"
FT                   /protein_id="ACP24415.1"
FT                   /translation="MERDFSEVKLLGFDVFGTVVDWRSGVARAVAPFLEARDIAIPPAE
FT                   FADRWRALYEPAMESVRSGKRPWVPLNELNLENLVAALAEVGLDVAAIPMEELEEINKA
FT                   WERLDPWTDSIEGLTRLKSKYKLAPISNGDIGGMTNLARFAGLPWDMILGAEVTRTYKP
FT                   QLATYIGSARKAGLEPGQVAMVAAHNYDLAAARRAGLKTVFITRTTEHGPGQKTDLQAD
FT                   SDWHVVGNDLVAVAQALGC"
FT   gene            677784..678632
FT                   /locus_tag="NGR_c06230"
FT   CDS_pept        677784..678632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06230"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06230"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24416"
FT                   /db_xref="GOA:C3MI68"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI68"
FT                   /protein_id="ACP24416.1"
FT                   /translation="MNDTANKIIAAGRVAVITGAAKGLGAAMARRVAAEGMRLALFDND
FT                   EDALKAFASTLRVDHVVVVGDVSNASDLQRLRDETRDRFEDVALLVNNAGITKGAGPWD
FT                   DPALWRRQLEVNFFAVVTAQHLFVPGMIEQSLPSAVVNLGSKEGITTPPGNAAYSVSKA
FT                   GIKVLTEQLSHELRKVTLGRVSAHLLVPGYTWTPMNFPGSDFAPGSKPDEPWTAEQVIE
FT                   LFIERFRNGDFYIICPDNAVAPALDAKRIRWAAEDMVRNRPALSRWHPDYKDEFARWLA
FT                   E"
FT   gene            678980..680482
FT                   /gene="pepD"
FT                   /locus_tag="NGR_c06240"
FT   CDS_pept        678980..680482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepD"
FT                   /locus_tag="NGR_c06240"
FT                   /product="aminoacyl-histidine dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06240"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24417"
FT                   /db_xref="GOA:C3MI69"
FT                   /db_xref="InterPro:IPR001160"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI69"
FT                   /protein_id="ACP24417.1"
FT                   /translation="MSVPANKVSHPQSSSVLAGLEPAIFFGFFEELSAIPRGSYNEKQV
FT                   SDHIAAFARARGLEVYQDDIWNLLIKKPGTPGFENAPTLILHGHTDIVCESDEGVEHDF
FT                   VNEGIKLRIDGDFIHGTGTTLGADNTVGVALAMSLLASDDIPHPPLEVVLTVQEEVGKG
FT                   GAQHFDGSKLTGKRLLDMNWHDPKSLFAGCAGDISAKFQIPLQWTDRAAGQKAALLRIS
FT                   GLSSGHSEFDIHLERGNAIMLLGRLLRLALKETDIGVISVNGGVNRYVIPGEAEAVISF
FT                   DPSRFDALKAAIENEGKAIAAEYSLSDPGLKVTLTETDSDVRSVFAPPVAKAMVSALNL
FT                   LPNGVQSRSLVVDNLVESSNTVALISNDQERIEIVSTVPSAVSSRRYNIVDKIRELADV
FT                   VGNDATVETFADCPEWPYNPNSRMLNAGRAAYQKEFGEQPHVEVSHSSLELGLFRKKVP
FT                   DIDMLSIGPEAFDVHTTRERLNHTTVDSTWRLLKALLSELRT"
FT   gene            680493..680963
FT                   /locus_tag="NGR_c06250"
FT   CDS_pept        680493..680963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06250"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24418"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI70"
FT                   /protein_id="ACP24418.1"
FT                   /translation="MTIPAYFGNFPFPPGDKKPHHLTADKFKMFIYTGNKPYSSDLNYL
FT                   LASTDKMTTGIYQLAPGSNFDPADIHAGDEVYYVLEGEVHLLNPETGHTERMGPGDSIL
FT                   IPMGVPHRGYNFTDKAAVILFCIAPRIWDEKGPPTGYFGATRLFKSERRVSE"
FT   gene            680960..681364
FT                   /locus_tag="NGR_c06260"
FT   CDS_pept        680960..681364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06260"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24419"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI71"
FT                   /protein_id="ACP24419.1"
FT                   /translation="MSLEKLGKYPVVGAEARSKGDLVKVAKENRLNLIFGQDHPVLMEL
FT                   CVSNDYMHVGEFVIPVGGVGPRASEPNRHDGDAVFYVLKGPATFYVADGDETFHIRDGE
FT                   AFFLPAGVSYQCLNYGSSPIRMVFTIAPGL"
FT   gene            681423..682526
FT                   /locus_tag="NGR_c06270"
FT   CDS_pept        681423..682526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06270"
FT                   /product="putative ribose ABC transporter, ribose-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06270"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24420"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI72"
FT                   /protein_id="ACP24420.1"
FT                   /translation="MSCTTREDLVTTFKRRTLLCAAVAFAASVGFQPAFAAEPDYNAVF
FT                   PGILMDKDIKPTGQEMKPVKKDNRPLKLGFLPTAMDTYYQRVLAGVKEEIDKRGGAEAI
FT                   ELLVQAPSSQSATDDQIRAMEAWINDGIDAIAVALYNEGALLPSIRRATEAGIPVFLFN
FT                   SPFADNPYYVSDVGYDQSDGGRAQAQWIVDTYGDKEVKIGILEGLPGPHTSQRMKGFNE
FT                   IISKHPNFKIVAQQPAGWVRAQGLSVTENMFTANPDIEVLVALYDEMALGGLQALKAKG
FT                   LNGKVAIVGYENMKEANAAILTGDFSATVDTGAKEEGRNIVRAVDEFLMKGNPLPKKIF
FT                   VSPKVYDATNIKTFDQTDYDYVPQQKM"
FT   gene            682575..684110
FT                   /locus_tag="NGR_c06280"
FT   CDS_pept        682575..684110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06280"
FT                   /product="putative ribose ABC transporter ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06280"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24421"
FT                   /db_xref="GOA:C3MI73"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI73"
FT                   /protein_id="ACP24421.1"
FT                   /translation="MANNPLLEMKGIGKRFGNMVALQGIDLALSGGEVLGLVGENGAGK
FT                   STLMKILAGAYSRDGGTIAVRGKEVELDSPKAGADAGIAIIYQELSLFPDFNAAENIFA
FT                   GRELRRSGFSLAPLSHGQMRREARRLLSEELGVEVAIDRPVRELSLSDRQMIEIAKALN
FT                   SNADIIIMDEPTEALEEVERKQLFAIINRLQAAGKAIIYVSHRIKELLGICSRVMVLRD
FT                   GRTAADLPVADLDVDKVVAAMIGGALSKQFPPRVPPRSDPSVEVRGLSRAGAFDDISFS
FT                   LAKGEIFGIAGLEGSGKSALLRALFGQRAYERGTVKVEGKDVQLTDITDAIRERFAFLP
FT                   AERKFEGIFPEHSVGWNLSIGNLGVLGKITLRPSKEKEVAASYISKLGVKCEGPQAEIS
FT                   SLSGGNQQKVMLARWLLTQPKVLLLEEPTRGVDVRAKSEVYALVQAAAQDGCTVIVVSA
FT                   DNAELLGLCHRVAVMFEGKITTVVDAATSKEETLALHSVRPPETLHPVGGING"
FT   gene            684103..685077
FT                   /locus_tag="NGR_c06290"
FT   CDS_pept        684103..685077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06290"
FT                   /product="putative ribose ABC transporter"
FT                   /note="permease"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06290"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24422"
FT                   /db_xref="GOA:C3MI74"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI74"
FT                   /protein_id="ACP24422.1"
FT                   /translation="MAEVAVTRPRHAFKFGLASGNSGVYIAFVVLLIALGFAAPRFFTV
FT                   GNLTDVLRQAVPIAVIAFGATFVIGMRGIDLSVGSTLALTGLVTANLLVLGYPVPVACL
FT                   AGLALGAFIGVINGLLITKIGITDFIATMAIMVVSRGVVMVYTQGIPITGASDPAFRMI
FT                   GQSYLAGVPVPVVLTVIVFAAAFYLLYYTRFGRFVLSIGSNPDAARLVGIPTDKVKIAV
FT                   YVLAGVLSAFAGIMLTSRLESAMPEAGQGYELDVIAAVVIGGTGLSGGRATLFGTVVGA
FT                   VLMAVVRNGLNLLNVNTFWHQVVIGTIILVAVAADRFNRSRKM"
FT   gene            685088..685798
FT                   /locus_tag="NGR_c06300"
FT   CDS_pept        685088..685798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06300"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /EC_number="5.1.3.4"
FT                   /note="phosphoribuloseisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06300"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24423"
FT                   /db_xref="GOA:C3MI75"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI75"
FT                   /protein_id="ACP24423.1"
FT                   /translation="MKHSALRKAVLDANFELYESGLVISTFGNVSAIDRVNGVVAIKPS
FT                   GVSYKAMDTGDIVITDLDGRVVNGDLRPSSDLDTHIELYKSFPTIGAVVHTHSFFATAW
FT                   AQSGQPIPVMGTTHADYFNGTIPVTRQLTDSEIRDDYVRNTGIVIAEALGNRDPLSIPA
FT                   ALVNDHGPFCWGKDAADAVHNAEMLEAVAKIAFHSRQISLESPEISAALLDRHFQRKHG
FT                   SGATYGQTGRSKQV"
FT   gene            685801..687417
FT                   /locus_tag="NGR_c06310"
FT   CDS_pept        685801..687417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06310"
FT                   /product="putative L-ribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06310"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24424"
FT                   /db_xref="GOA:C3MI76"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI76"
FT                   /protein_id="ACP24424.1"
FT                   /translation="MSIVAGVDFGTLSVRVTLADTLIGPLGTAIAEYPLRRTRSDPDLA
FT                   TQAHADHMDGLVLAMKRAIKDCGVDPKALRAIAVDTTGSSVIPVDRNLNPLSDYYLWCD
FT                   HRAKSEAEEITAMAHETHLEAIEWCGGTYSHEWGFAKLLHWLRHNPKLRGRFGTALEHC
FT                   DMVAAVLTGVTDSSAVVRSVCAMGHKWMWNPKWGGLPSQAFLSRVDPLFDGVREKIGGT
FT                   YQTSAKLAGGLSSEWAAKLGLQEGIPVPVGAFDAHWDAIGAGCRLGDVVNVIGTSTCII
FT                   AVSERVKLIPGVCGVVPGSAHPDLVGVEAGLSATGDIFDAIARRASTTVSKLSEGLETI
FT                   EGGKTGLMRFSWDNGDRTVLVRSDLGGMTIGWHLGHTAQDELYAAIEGTAFHTRIILER
FT                   MEQHGVPVNRVINGGGVPQKNPVLNQIYANVLGKPILVPDGLPTGLGSGIFASLASKDH
FT                   ATIEAAQAAMCVGFKKFDPNPSTRSRYELLYQLYKQVYMGFGTSSLGDFSQVLGDIKRI
FT                   AAGEPVRSDVGHRVPRKVASL"
FT   gene            687464..688420
FT                   /locus_tag="NGR_c06320"
FT   CDS_pept        687464..688420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06320"
FT                   /product="putative transcriptional regulatory protein, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06320"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24425"
FT                   /db_xref="GOA:C3MI77"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI77"
FT                   /protein_id="ACP24425.1"
FT                   /translation="MTSIPSIRAILSFVAAGRRGSFLEAAAQLQLTPSAVSHQIRLLEE
FT                   GLGEKLFHRIGRNVTLTEIGERYHRDLSEALSLIERATDEVSRRNSVDVLSVGCAPSLA
FT                   SLWLMPRLPQFESLHPSLEIRLISSSEPTKLSDGSVDVDICYGSVPRLGSIATEEFPLE
FT                   TIVVACAPEVANGERPIRRPSDLVGHTLIKSEQTLYSWRQWAKDHGLEIDLNRGSRFRD
FT                   AFMSIATAVEGRGVCLESYRLLQRDVERGNLVLPFGMTGPNLRCHTLTYVRSRLRSQKV
FT                   SAFKQWLESAWLEDAAALEMGSRASVGDRHQEHPFGL"
FT   gene            688520..688744
FT                   /locus_tag="NGR_c06330"
FT   CDS_pept        688520..688744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06330"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24426"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI78"
FT                   /protein_id="ACP24426.1"
FT                   /translation="MRRAFLLSSWSTTICILVEFAQLPFRSEAICRSKPYSDRRENPRG
FT                   RVLLRKGLRRLLSTKFLTAVRLPVCLTMV"
FT   gene            688806..689903
FT                   /locus_tag="NGR_c06340"
FT   CDS_pept        688806..689903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06340"
FT                   /product="putative exported solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06340"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24427"
FT                   /db_xref="GOA:C3MI79"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI79"
FT                   /protein_id="ACP24427.1"
FT                   /translation="MRIGSLICGGIAALIVAMTTSAQAETRTLRFQSAYPASSTIYMSA
FT                   ETWAKRVEELSGGRLKIEFMPAGTIVPAFEVLDAVNKNVIDGGHSTVAYWVGKHRAGTL
FT                   FGDAAGGPFGMDILDYVGWLYEGGGIELYRDYYRVELKTNIEVIPSVTSANQALGWFAR
FT                   PVESWADLKGRKCRQTGVTAEVFASSGMSTVNMPGGEIVPAGERGVIECAEFVGPAEDM
FT                   GIGFQTIWKHFYPMSTHNPATIVDFLVNGDVWNSLAPDLQAIMQAAASEATLRSHIRKG
FT                   KLDADALDKMRNEDGVTVHRTPDDILRNILASWDEIAKKESESNAFFKKVYDSQRDYAS
FT                   KVVPAKRLIQAPYNLGADHYWPEAK"
FT   gene            689959..690522
FT                   /locus_tag="NGR_c06350"
FT   CDS_pept        689959..690522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06350"
FT                   /product="putative transporter DctQ-related transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06350"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24428"
FT                   /db_xref="GOA:C3MI80"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI80"
FT                   /protein_id="ACP24428.1"
FT                   /translation="MSKPAPPFSPAALRAIKIIDGFTEKFVLLVAVLTIPLVLSNTVEV
FT                   VSRYLFSSPTIWAADATVMSYGAIFMLGSSYALLKGAHVRTDIFWESFSDRKKGAIDAV
FT                   CYVALFLPVMAIIFYMSLDDFLYSYEINEKSTLSLWMPVIWPLRGVIPLTAVLLFFQGI
FT                   SELLKSLFAVTTGRAFETHEKIEI"
FT   gene            690535..691872
FT                   /locus_tag="NGR_c06360"
FT   CDS_pept        690535..691872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06360"
FT                   /product="putative TRAP family transmembrane transporter
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06360"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24429"
FT                   /db_xref="GOA:C3MI81"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI81"
FT                   /protein_id="ACP24429.1"
FT                   /translation="MSFNDILSVAMLGGMLAFIFVGFPIAFTLLFIALVFGSIGIGVNI
FT                   TFSLAYLQIFGTMKDDILPAVPLFIFMGYMTEQAGLMNRLFGSMRQIMAPLSGSLFLAV
FT                   LLTATIFAMATGIVGAAVTVLGIMAGPMMIKAGYDAKLSAGAIAAGGTLGILIPPSVML
FT                   VVMGPTLGVPVNQLYGAAMAPGFMLAVCYATYCVARSYINPRVGPILPIEERVGSAIEI
FT                   TREFVVGVLPLCLLIVATLGSILSGLATPTEAASCGAVGATILALAYRKLSFWTLKNAA
FT                   VATVVTSSMVLLLAVASNVFGAVFTQQGGAAIITDVVTSIPVSDMWKLVIIMVIIFALG
FT                   WPFEWPAIVLVFLPIFTPIVLQLDLGMTKPELLLWFGVLVAVNLQTAYLSPPVAMSAYF
FT                   LRNVVPQWSLKLIYSGMGQFMVIQIVFLIALLMWPSLVLWLPSVLK"
FT   gene            692205..693206
FT                   /locus_tag="NGR_c06370"
FT   CDS_pept        692205..693206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06370"
FT                   /product="putative AraC family transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06370"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24430"
FT                   /db_xref="GOA:C3MI82"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI82"
FT                   /protein_id="ACP24430.1"
FT                   /translation="MRRGNLAGKEDYVVVECTDPAELSSILSGSETKVTVKPTARSGIQ
FT                   FRCEYAAAELLGLALCRYQGSAVFEHESANEKYLIFLPRYGFAAINVNGARVLTSPRQG
FT                   AIVACQQAKSLTLSGPMEHLVVVVDRATLSSRLMDMLEVPVSGGFDFFPEIDLTAGPGL
FT                   IIAQTAAALHSGLAASAALRNAPVARTSFANALVELLLESLPHRHTSELNRRTSPMPRH
FT                   VKRAVEFMRANLSKPLTIQEIALASGSGIRSLQDGFRRFKQTTPSSYLQYLRLDAVHQE
FT                   LLQAKSSQTVCDIARKWGFSHSGRFAADYRKRFGQAPSQTLQSSSFRIRPPG"
FT   gene            693626..694342
FT                   /locus_tag="NGR_c06380"
FT   CDS_pept        693626..694342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06380"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06380"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24431"
FT                   /db_xref="GOA:C3MI83"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI83"
FT                   /protein_id="ACP24431.1"
FT                   /translation="MLDEPKKTQTRLELALDYITGEIARGNLKAGDKLPNEKELAEQLG
FT                   ISRTPIREAMKTLSVAGLIDIRHGHGSYVREGPGLPSMPLTLFQLYLQDSTPEMLMELR
FT                   DIFDRNCTEIAAQRRTERDLAKMRECIDRLKALTQQPGASLDDMLKADLDFHRAVYEAS
FT                   GNILIVTIAEFVLNMVAPWVKKSLDVSGRVRAVELHEQMYGSIRDRTVGQKNRVSVEAN
FT                   MQHFKQSLDTATSKAG"
FT   gene            694506..695387
FT                   /locus_tag="NGR_c06390"
FT   CDS_pept        694506..695387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06390"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24432"
FT                   /db_xref="GOA:C3MI84"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI84"
FT                   /protein_id="ACP24432.1"
FT                   /translation="MSAKRKLIIEARLNEYMSRSANPNVPFTAEEIALEAAKAREAGAS
FT                   IVHFHARGAEGAPAHGAEDYAKAITAIRDACDCLVYPTLGQITKDGRESRLAHLEVLAK
FT                   DPATRPDIAPIDTGSTNIDRFDPEARKFLSDTMTYRNDVATLKLFAKRLPELGVKPQFV
FT                   SWTVAFTRTFEALREMGLVVDPAYLMFELTDQGILGGHPGTVKGLLAHLDFLPAQPLEW
FT                   SVCNKIGNITAPAAAAIEMGGHVSVGLGDYGWPELGTPNNGDVVRHIANLARAMGREIA
FT                   APDEAREMLGLR"
FT   gene            complement(695505..696206)
FT                   /locus_tag="NGR_c06400"
FT   CDS_pept        complement(695505..696206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06400"
FT                   /product="putative transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06400"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24433"
FT                   /db_xref="GOA:C3MI85"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI85"
FT                   /protein_id="ACP24433.1"
FT                   /translation="MLNSQKKPQTRVEFALDYITKEIAQGNLRAGDKLPNEKDLAEQLG
FT                   ISRTPIREAMKTLAVAGLIDIRHGHGSYVREEKGAPALPLNLFQLYLQDSTPEMLMELR
FT                   DIFDRNCSELAAQRRTDEDLARMRECIDRLKALTEQPDASLDDMLKADLDFHRAIYEAT
FT                   GNKLIMTVAEFVLNMVAPWVRKSLDVSGRVRAVDLHEQIYDAILKQEIGPQNRMSVDAN
FT                   MQHFMQSLDKE"
FT   gene            complement(696355..697146)
FT                   /gene="fabG2"
FT                   /locus_tag="NGR_c06410"
FT   CDS_pept        complement(696355..697146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG2"
FT                   /locus_tag="NGR_c06410"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="3-ketoacyl-acyl carrier protein reductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06410"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24434"
FT                   /db_xref="GOA:C3MI86"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI86"
FT                   /protein_id="ACP24434.1"
FT                   /translation="MRLNGKTAIVTGAARGIGRAIAVAFAREGAQVVVCDRDEEAAKLT
FT                   AEEIGSAALAVRADISVDEDVSGLVDQALARFGKIDILVNNAGIGATTLFLESSREEFE
FT                   RVVRINLTGTFLVSQAVARTMAEHKSGSIVNIASLSGQKGGVGRSAYGASKAGVELLNK
FT                   VMAVELADHGINVNAIAPGPILTEVSRTMHTIETREAYHRLVPQRRYGEPEEIADAAVF
FT                   LASEEARYITGHTLNVDGGFLAAGLLFPFDPKTSKKLGDER"
FT   gene            697284..698630
FT                   /locus_tag="NGR_c06420"
FT   CDS_pept        697284..698630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06420"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06420"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24435"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI87"
FT                   /protein_id="ACP24435.1"
FT                   /translation="MEGKRPLVGFYGDDFTGSSENLAQFHRNGLRTRLYLRVPSQETLA
FT                   EATRDLDVVGFAGTARALDNSQITAEVFPAFKALGALGCTFLQYKICSTFDSAPQVGNF
FT                   GFAAEQLAGGGGEYDLVVLAATPDFGRYTAFGNHYAKFGSEIVRLDRHPSMSNHPRTPM
FT                   KESDLRRHLADLCSLDFTNIFLPEIRDEATLSKRLENLLANRKGVVFDGVDNRDLDNIA
FT                   SALWEHHKKRPVFAIAAQGLAQALGKQLAKHKNPLDLLDVGTTIAPASNLLVLSGSCAI
FT                   QTGRQIDAAVQAGWAALELNPLELTDGRAVARKIELVKPQIMAHLANERPTIVYTARGH
FT                   AMDRDRFEDIPPQLIGEAYANLMVAARRETDVQRVVLAGGDSSSYAVRQSAAESLTIKV
FT                   FDRVQHGHLCELMGGGLDGLEVLLKGGQVGDDDYFMRVLHGTEKQHVEA"
FT   gene            698632..699513
FT                   /locus_tag="NGR_c06430"
FT   CDS_pept        698632..699513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06430"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24436"
FT                   /db_xref="GOA:C3MI88"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI88"
FT                   /protein_id="ACP24436.1"
FT                   /translation="MKKLILEARINEYAMRDHNRNVPWTSDEIAETAARVREEGASILH
FT                   FHARTVDGQPWNTFEAYDDIIRKVKAKSDILILPTLGFISNDADARNRIDNVVRLAQDP
FT                   ITKPDIAPIDTGSANLETFDRESGNVSFAERIYVNTTDSLVHYARELKQAGVKPKMVSW
FT                   SVGFTRRALMLMDMGLIDEPGYMLFHMTDGKTITGHPGTRQGLEAHLMFLPPDRRIEWT
FT                   ANVLGGNLLALADTIATRGGHLAMGIGDYPYPELDYPSNEVLIRETVRVIRAAGREPAT
FT                   PEEVRQMLDLSN"
FT   gene            699661..700068
FT                   /locus_tag="NGR_c06440"
FT   CDS_pept        699661..700068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06440"
FT                   /product="putative short chain oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06440"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24437"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI89"
FT                   /protein_id="ACP24437.1"
FT                   /translation="MNSGRPLAMVTGASSGIGFELARQFAKKGFDIALSGSSEKIFEAA
FT                   EKLRSDGTETFAFRADAGTYEGVEAFWRFVMHLKRPVDACAPNVTIAVGGAFAETALED
FT                   DLRVIAVNVTGTVHMRNTSSGIWLRTAMAAF"
FT   gene            700038..700445
FT                   /locus_tag="NGR_c06450"
FT   CDS_pept        700038..700445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06450"
FT                   /product="putative short chain oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06450"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24438"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI90"
FT                   /protein_id="ACP24438.1"
FT                   /translation="MVANGNGRILIVSSVSATSPTPFETTYGPSKAFGFSFAESLREEL
FT                   RGTGVTVTALLPGATNTKFHANAGMADTPIGKAMKNDRELVAKQGFDALMNDIDHVVGG
FT                   DDATKQVVIENRKLTETVKAARHAAIARIGT"
FT   gene            complement(700524..702149)
FT                   /locus_tag="NGR_c06460"
FT   CDS_pept        complement(700524..702149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06460"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /EC_number="5.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06460"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24439"
FT                   /db_xref="GOA:C3MI91"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI91"
FT                   /protein_id="ACP24439.1"
FT                   /translation="MKTIVEQLKSVVSATNATDIRAAFAADPNRFSRFSTRLGDLLLDY
FT                   SKCAANDRVIDGLEALAKAARIEEKRDAMFRGDIINITEERAVLHTALRNRSNRPVLVG
FT                   GKDVMPDVNAVLDAMGAFADGIRSGALKGATGKKITDVINIGIGGSDLGPVMATLALAP
FT                   FHDGPRLHFVSNVDGAHIADTLKLLDPETSLFIIASKTFTTIETMTNAQTARSFIAGKL
FT                   GEAAVGHHFAAVSTALDKVAVFGIDQARVFGFWDWVGGRYSIWSAIGLPLMIAIGKENF
FT                   GRFLDGGHAIDEHFRTAPIRENIPVLLGLLGFYHRNVLGYPSRAILPYDQHLSRFPAYL
FT                   QQLDMESNGKGVTLDSTPVEFSTGPVVWGEPGTNGQHAFYQLIHQGTDIIPAEFMIAAN
FT                   GHEKDLRHQHQLLIANCLAQSEALMKGRTLDEAKAQLTSKGMDEAKADKIAPHRVFTGN
FT                   RPSLTFVYDQLDPFALGRLIALYEHRVFVEGALFNINSFDQWGVELGKELATGLLPVVE
FT                   GKESADGHDSSTAGLVAALLKAQG"
FT   gene            complement(702210..703472)
FT                   /gene="rbcL2"
FT                   /locus_tag="NGR_c06470"
FT   CDS_pept        complement(702210..703472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbcL2"
FT                   /locus_tag="NGR_c06470"
FT                   /product="ribulose bisphosphate carboxylase large chain 1"
FT                   /EC_number="4.1.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06470"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24440"
FT                   /db_xref="GOA:C3MI92"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR020878"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI92"
FT                   /protein_id="ACP24440.1"
FT                   /translation="MNRNDCVVMTYMIECDGDPQSFASKIASDQSTGTFVDLPGETPEL
FT                   KARVAARVLDVRELPPISVPSIPQNASGPSYRRAEADIAFPIEAVGDDLSALMTITIGG
FT                   VFSIRGFTGIRVLRMQLPHAFGASYPGPQFGIAGTRRLTGVFDRPLIGTIIKPALGLRP
FT                   NETAEMVSELIASGVDFIKDDEKLCGPPYSPLEERVRAIMPLIKDHEQRTGKKVMYAFN
FT                   ISHVDPDVMMRNHDVVADAGGNAAVININSIGQGAFLFLRRRSRLALHAHRNGWDILTR
FT                   HPGLGMNFSVYQQYWRLLGVDQFQINGIGSKYWEPDDSFVQSFHDLVAPFTSAGEKPMP
FT                   VVCSGQWGGQAPETYRRTGRTLDLLYLCGGGVVSHPDGPGAGVKAVRQAWEAAREGVDL
FT                   DSYAQNHPELKQALAKFGKRD"
FT   gene            complement(703507..704373)
FT                   /locus_tag="NGR_c06480"
FT   CDS_pept        complement(703507..704373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06480"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24441"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI93"
FT                   /protein_id="ACP24441.1"
FT                   /translation="MGAHSVWVLEYARSPVHPVSGVYYGAHNQGTMNLPFAYILIRTAD
FT                   AVALVDVGHDANDFGGEIANSIGVTGWTPPEIVLGECGVRPEDVTHIFITHAHFDHIGG
FT                   LKFFPNAKIFIQKKELESWMWILAKGRRFRSLLAGLNPADILYLTQANIEGRLELLEGP
FT                   REDVLPGIHLYPAHDTHTAGSQYVVVQNRGSDDRLVLSGDVVYTYRNLTGDDQLDPCFV
FT                   PPGLANGSQTKLIQAAEEMLGIVGNDERRIIPVHEEKLAQFYPSRLSDHGLRIVEICVA
FT                   DGEQSRV"
FT   gene            complement(704345..704845)
FT                   /locus_tag="NGR_c06490"
FT   CDS_pept        complement(704345..704845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06490"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24442"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI94"
FT                   /protein_id="ACP24442.1"
FT                   /translation="MGYQRALIPFSCNEVANAVELQEQRSGLETLVRAYGEVLALFSFM
FT                   HLGLREPGMNLLFAQLSCRAADILESVGQGGDKRRRLAALEHAARHLGRVRSDLLQAQR
FT                   SFEGLLGRQSTELLRLLTRASLELKRASALLGTMTFDASGCCAGPLFANAEETHGSAFR
FT                   LGA"
FT   gene            complement(704851..705894)
FT                   /locus_tag="NGR_c06500"
FT   CDS_pept        complement(704851..705894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06500"
FT                   /product="putative aldo/keto reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06500"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24443"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI95"
FT                   /protein_id="ACP24443.1"
FT                   /translation="MMSDLAKRPLGKSNVRVTSLGLGTVPISGFNADVSYDEFEQTILS
FT                   GYAAGIRYFDCAPMYGFGKSEHFLGHALRVNKLRDDVVVSTKVGRVLKPASRTKKLDTV
FT                   YGIEWIDPLPFLDTYDYTYDGIMRSFEDSQQRLGLDYIDVLLVHDVGRAWHGDRSEFYW
FT                   DQLRASGYKALDELRSTGCVSAIGLGVNETDSVVGVSREFPIECALVAGRYTLLNHEPL
FT                   HSAFDELLSRNVSIIAGGIFNSGILASGTSGATATYDYGKVPAAVLDRVKSIEAVCEEY
FT                   RVSLPAAAMQFVYAHPAVATLVMGAKSSAEVDQNVAAINERIPPAFWNALQSADLLPAT
FT                   APLPAEA"
FT   gene            complement(705922..706824)
FT                   /locus_tag="NGR_c06510"
FT   CDS_pept        complement(705922..706824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06510"
FT                   /product="putative aldo/keto reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06510"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24444"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI96"
FT                   /protein_id="ACP24444.1"
FT                   /translation="MRYFDTAPLYGLGKSEHSLGHVLRVNGIIEDVVISTKAGRILKPA
FT                   SRSKRAESLYGINWIDPLPYVDEYDYTYDGIMRSFEDSQQRMGVDGVDILYLHDVSGVW
FT                   HRDSYDLYLSQLRQSGYRACDELRSSGAVKAIGLGVNETASVLQVAAEFNLDCSLVAGR
FT                   YTLLNHQPLEDFFPEAQRRGIAIIAGGVYNSGVLAEGSKGAAAVRTYDYQTASPEILKR
FT                   VEALEAVCGEFGISLATAATQFVYSHPAVTAVVQGALSTAHVEANVKAISEKIPPGFWS
FT                   ALKAKSLIPEAAPIMTSAA"
FT   gene            complement(707028..708011)
FT                   /locus_tag="NGR_c06520"
FT   CDS_pept        complement(707028..708011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06520"
FT                   /product="putative solute-binding component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06520"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24445"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI97"
FT                   /protein_id="ACP24445.1"
FT                   /translation="MINRRTFIAAIAASTMLLGADLAAAQEKIRIAALSFGEAGEYMKA
FT                   WSTEIQNHPAVKEGKVEITVFDGKYDPLIQANQIDTALTQQFNAIIMAPFDLEASAPAI
FT                   DKAAEAKVPVIVSALKTSSKNYTASIIVDDREGGRIIAEEMAKRLPSGGNLVLMEGPIG
FT                   QSAQIERRAGVDAGLEAHSNLKLLADKSGNWSRAEGQALMENWLSAYPDQINGVLAEND
FT                   EMALGAIEAMKAANVDLSKVPVIAIDGIPDAKRAVENGEMAVTLYKYARAEGQGAVDLA
FT                   LRQVIGTEYKPQSEVWNGLMEWKDGTQKDYVVPWLILDKDNVKKYM"
FT   gene            complement(708048..709034)
FT                   /locus_tag="NGR_c06530"
FT   CDS_pept        complement(708048..709034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06530"
FT                   /product="hypothetical ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06530"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24446"
FT                   /db_xref="GOA:C3MI98"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI98"
FT                   /protein_id="ACP24446.1"
FT                   /translation="MNANITKIATGTPSERRKAEITKDFIKSFSIILVFLAICVLFTSL
FT                   NQYFLTWNNWLNLLRQSSINGILAIGVTFVILTKGIDLSVGSVMALAGMMAANLVTTGN
FT                   EHLVIWSILAALGTGAVVGLANGVLIARINVPPFVATLGMLSMARGLTLIYSDGRPIAN
FT                   LTASLRWIGSGNVLGLPVPVLIFFAVFLIGWLTLSRTTFGRYVYAVGGNEKAARTSGIS
FT                   TRTIIAATYVICGLLAGLAGLVLTARTTAALPQAGIGYELDAIAAVVIGGTSLSGGRGS
FT                   LVGTLFGALIIGTINNGMDLMGVSSYYQQLLKGAIIVLAVIADQIRK"
FT   gene            complement(709105..710652)
FT                   /locus_tag="NGR_c06540"
FT   CDS_pept        complement(709105..710652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06540"
FT                   /product="hypothetical ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06540"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24447"
FT                   /db_xref="GOA:C3MI99"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MI99"
FT                   /protein_id="ACP24447.1"
FT                   /translation="MALGGFMTTGSVTFDTTLHSTTGNGLLLEADGVAKAFHGVPALRN
FT                   GHLKLRPGSVHALCGGNGAGKSTFLNIVMGLLRRDEGSIKIKGEVVDFRSASEALDHGI
FT                   AIITQELSPVLEMTVAENIYLGREPKRLGAFIDFALLETQAQKLLDDIGFPIRANARMS
FT                   NLSLAETQLVEIAKALSFDADIVIMDEPTSAIGEHEAHILFAAIDRLKHRGSGIIYVSH
FT                   KLSEIFEIADEFTVFRDGNYIVSGSMKETTRKELVTHIVGREVKVVEKERPNAGAPILL
FT                   EVRNLSRESEFKDISISVAAGEVFGIYGLLGSGRTEFLEAVYGMETPTSGEVMLAGRPV
FT                   PRGKPRESIKMGMAMVSEDRKDSGLVLSSSIAHNITLSALSLMAVSGFVKQQKEREVVE
FT                   EMIRSQRIKTSSSELAVENLSGGNQQKVVFARCLTTNPRLLICDEPTRGIDEGSKQEIY
FT                   AFLRDFAAKGHGVLVVSSEAPEILQVSDRIAIFKAGTLVDVIDGHGATQQMIMELAS"
FT   gene            710750..711763
FT                   /locus_tag="NGR_c06550"
FT   CDS_pept        710750..711763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06550"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06550"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24448"
FT                   /db_xref="GOA:C3MIA0"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIA0"
FT                   /protein_id="ACP24448.1"
FT                   /translation="MIIDVAADPAAGITSAVEALGRGDVIAVPTETVYGLAADATNEAA
FT                   VSQIFDIKRRPGFNPLICHCSDLEMVSEFATLDPVSLRLAERFWPGPMTLVLNSNPGRL
FT                   PSVTTAGLTTVAIRIPMGFSNGLIRSYGGPLAAPSANISGRVSATTAAHVESEFGDGVP
FT                   LILDGGPTKIGVESTILRVRENGIELLRPGGLPIELVEHAAGLQVSAPNLFRKVLAPGM
FT                   LTSHYAPRAMVRLNATGVGPGETLLKFGDAIVPGEGACARVFNLSPEGSLEEFAAKLYA
FT                   TLKEADDAGAESIAIVPIPDEGLGLAINDRLRRAAAPRTLTLGELEQAAVRNREAR"
FT   gene            complement(711938..712918)
FT                   /locus_tag="NGR_c06560"
FT   CDS_pept        complement(711938..712918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06560"
FT                   /product="putative oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06560"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24449"
FT                   /db_xref="GOA:C3MIA1"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIA1"
FT                   /protein_id="ACP24449.1"
FT                   /translation="MQYVRLGATGLKVSRLALGCMSFGEPERGNHQWTLAEAEARPLFQ
FT                   QALDAGINFLDTANVYSDGTSEEIVGKLLKEHGRRDEIVLATKVFGRMNASPNGAGLSR
FT                   KAILSEVDNSLRRLGTDYIDLYQTHFWDSETPIEETLEALNDVVKAGKVRYIGASNMYA
FT                   WQFATAIQISKRNNWAAFASMQLHLNLIYREEEREMLPLCRAEGIGVMTFSPLARGILT
FT                   KGSGSQSKRAETDNVTGRFYEKAAAADRVVVDEVAKIAVERGLPQAQIALAWVLQKQGV
FT                   TCPIIGATKPSHLQDAVGSLAVKLTDDEIQRLEAPYVPHDVVGLM"
FT   gene            713124..715115
FT                   /gene="cbbT"
FT                   /locus_tag="NGR_c06570"
FT   CDS_pept        713124..715115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbT"
FT                   /locus_tag="NGR_c06570"
FT                   /product="transketolase I"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06570"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24450"
FT                   /db_xref="GOA:C3MIA2"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIA2"
FT                   /protein_id="ACP24450.1"
FT                   /translation="MTAVSVRDLANAIRVLSIDGVEAANSGHPGMPMGMADAAAVLFGK
FT                   HLKFDASEPGWPDRDRFVLSNGHGSMLLYSLLHLTGYKEMTIEEIRNFRQWDSKTPGHP
FT                   EYGHTAGVETTTGPLGQGIASAVGMAIAERRLGAEFGTALVDHHTYVFCGDGCLMEGVG
FT                   QEAASLAGHLQLGKLIVLYDDNSITIDGSTAIAFSEDVLARFDAYGWHTQRVDGHDAEA
FT                   IDAAISNAKAETSRPSLVALKTIIGFGSPSKAGKSSVHGAPLGASEAAATKTAYGWTAD
FT                   PFEIPTPILETWRAIGAKGAKSRREWQARLEAAEPDVKSEFERRTAGSLPPHYEETVNA
FT                   AKANLLDRPQSVATRKASQIALEALTELLPEMIGGSADLTHSNLTRVPAVDSDFTAVRS
FT                   GRYVSYGVREFAMAAAMNGMAVHGGFIPYGGTFLVFSDYCRNAIRVAALMGARSIFVMT
FT                   HDSIGLGEDGPTHQPVEHLASLRAMPNLHVFRPADTIETLECWDIAITSKNTPSVLALS
FT                   RQNVPQLRSERDGSNRCARGAYVLREASRERAVTLIATGTEVVLAIQAAEELEARNIPA
FT                   AVVSMPSWDLFEKQARDYRHAVLGDAPRIAVEALSKFGWTRYVDSEDDVIGMSGFGASA
FT                   PAETLYEKFGITRDAIVARAVARVRGEE"
FT   gene            715112..716134
FT                   /gene="cbbF"
FT                   /locus_tag="NGR_c06580"
FT   CDS_pept        715112..716134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbF"
FT                   /locus_tag="NGR_c06580"
FT                   /product="fructose-1,6-bisphosphatase I"
FT                   /EC_number="3.1.3.11"
FT                   /note="D-fructose-1,6-bisphosphate 1-phosphohydrolase;
FT                   FBPase I"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06580"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24451"
FT                   /db_xref="GOA:C3MIA3"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR020548"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIA3"
FT                   /protein_id="ACP24451.1"
FT                   /translation="MSTPATLASDEASFQHESVDEYLSTWAGEDRSRQRVTALINGVLD
FT                   AACLLSERIATGSLEGDPARLVGSNSDGDAQKAIDVASHALFVEILERAGAGRILSEEA
FT                   DEPVVFKGSGFGVAIDPIDGSGNVGLGAPVGTLFSIIPFTETEDPFLTSGRRQVAAGYV
FT                   SFGNTIDLGFSVGDGMLLATMHPQTGEFLIVRRQVRIPPDTSELAFNASVHRHLQSGLS
FT                   LYVQDCLAGSAGSRGRDFNMRWLGSAVGELHRILLRGGVFFYAADKRPGYQNGRLRLVY
FT                   EANPIAFLMEQAGGRATDGTSAILDKVPTSHHCRTPLVFGSATEVDLIASYLNSNPTSE
FT                   "
FT   gene            716141..717190
FT                   /gene="cbbA2"
FT                   /locus_tag="NGR_c06590"
FT   CDS_pept        716141..717190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbbA2"
FT                   /locus_tag="NGR_c06590"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06590"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24452"
FT                   /db_xref="GOA:C3MIA4"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIA4"
FT                   /protein_id="ACP24452.1"
FT                   /translation="MARITLRQLLDDAAEHGYGVPAFNINNMEQALAIMEAADDTDSPV
FT                   ILQASRGARAYVNDIMLKHMMDAVTEIYPHIPVCVHLDHGNEPSTCVTAIQHGFTSVMM
FT                   DGSIRADGKTPADWDYNVKVTKSVSETAHWAGVSVEGELGVLGSLETGMGEAEDGHGVE
FT                   GKLDLHQLLTDPDEAAKFVEETKVDALAVAMGTSHGAYKFSRRPDGDVLAMDVIEAIHR
FT                   KLPNTHLVMHGSSSVPEELQEIFNSFGGRMKPTWGVPLDEIQRGIRHGVRKVNIDTDCR
FT                   MAMTGQVRRVLAEDPTEFDPRKYLKPAMTALSKLCRERFEAFGTAGRASSINVIPLAEM
FT                   AKRYRAGSI"
FT   gene            717225..717974
FT                   /locus_tag="NGR_c06600"
FT   CDS_pept        717225..717974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06600"
FT                   /product="putative DeoR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06600"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24453"
FT                   /db_xref="GOA:C3MIA5"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIA5"
FT                   /protein_id="ACP24453.1"
FT                   /translation="MKRDERRQQIIDMLVENKTVGLDELADHFAVSKMTIHRDLDDLDQ
FT                   EGVLRKVRGGATIDAGTRFESDFRIRARQDNAAKIGMAQAALELVEPGMTAVLGVMLPQ
FT                   KRPLTLITNNAEIMERLKGEFGITLIALGGMYSAKFNAYLGIVTEDALSRLRADIAFIS
FT                   TPAMSGRIAYHMDDNVVRAKRAMISSSARACLLVNHQRFGHTALNVLADVAEFDAVITD
FT                   RAPGTAVLDEFERAGIKLTIASTQDPT"
FT   gene            717971..718756
FT                   /gene="tpiA"
FT                   /locus_tag="NGR_c06610"
FT   CDS_pept        717971..718756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tpiA"
FT                   /locus_tag="NGR_c06610"
FT                   /product="triosephosphate isomerase 2"
FT                   /EC_number="5.3.1.1"
FT                   /note="TIM 2"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06610"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24454"
FT                   /db_xref="GOA:C3MIA6"
FT                   /db_xref="InterPro:IPR000652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020861"
FT                   /db_xref="InterPro:IPR035990"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIA6"
FT                   /protein_id="ACP24454.1"
FT                   /translation="MTGKSRFWIGTSWKMNKTLAEAEHFVRGLKAADATHDPRIQRFVI
FT                   PAFTVLREVRAMLAQTSVKVGAQNMHWADQGAWTGEVSPLMLKDCNLDLVELGHSERRE
FT                   HFGETDETVGLKTEAAVRHGLIPLICVGETLRDRDSGNAPEVLAAQVRGALSKLTASQK
FT                   TAEVLLAYEPVWAIGEKGIPATAEYAGARQAEIIAVAEEVVGRKVPCLYGGSVNPQNCE
FT                   ELISSPHIDGLFIGRSAWNVEGYLDILAKCAAKLRGERE"
FT   gene            718753..719226
FT                   /locus_tag="NGR_c06620"
FT   CDS_pept        718753..719226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06620"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06620"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24455"
FT                   /db_xref="GOA:C3MIA7"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIA7"
FT                   /protein_id="ACP24455.1"
FT                   /translation="MKVAIAGDSAGEGLAKVLAEHLKGRFDVYEVSRTEAGPDRFYANL
FT                   SERVASGVLDGTYDKAILVCGTGIGVCIAANKVPGIRAALTHDTYSAERAALSNNAQII
FT                   TLGARVIGPEHAKSIAETFLGKTFDEGGQSAGNVRAINDLDSKYHPRAPSSSR"
FT   gene            719162..720943
FT                   /locus_tag="NGR_c06630"
FT   CDS_pept        719162..720943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06630"
FT                   /product="NAD(P) transhydrogenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06630"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24456"
FT                   /db_xref="GOA:C3MIA8"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIA8"
FT                   /protein_id="ACP24456.1"
FT                   /translation="MSGRSTTWTASIIPARQARADRRRTGGTAASASGNWSRARQTLKQ
FT                   YGVSTFAPSRCRRAGNRDISCREAAVRIGALRERYPEEARVALTPESAVQLRKLGHNCL
FT                   IEAGAGSRSGISDDAYRSVGVEVVPDARALIAASDVVVKVRSPEGDEAKSLNDGQTLIS
FT                   FLWPAQNPDLLETFRDKNITAVAMDMVPRISRAQKMDALSSMANIAGYRAIIEAGNQFG
FT                   RFFTGQVTAAGKVQPAKVLVVGAGVAGLAAIGTAVSLGAIVHAFDVRPEVAEQIESMGA
FT                   NFVFLEFEANQDGAATGGYAAPSSPEFREKQLAKFRALAPEIDIVITTALIPGRPAPKL
FT                   WLEDMVAMMKPGSVIVDLAAERGGNCDLTVPDQRIVSPNGVVIIGYTDFPSRMAAQASI
FT                   LYSTNIRHMLADLTPNKDGVINHNMEDDVIRGATVTKGGEITYPPPPPRIQAIAPAKPK
FT                   EKVREPTAEEMRAAEAAAFRKQTTSQVGLLVIGALLLALIGSYVPSEFMAHIVVFALAC
FT                   FIGFSVIWNVSHSLHTPLMAVTNAISGIVVIGALLQIGSGNWLVVILAALSVLVATINI
FT                   VGGFMVTRRMLAMFQRS"
FT   gene            720957..722402
FT                   /locus_tag="NGR_c06640"
FT   CDS_pept        720957..722402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06640"
FT                   /product="NAD(P) transhydrogenase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06640"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24457"
FT                   /db_xref="GOA:C3MIA9"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIA9"
FT                   /protein_id="ACP24457.1"
FT                   /translation="MNLGLVSATYLFAAVLFILSLGGLSGQESAKRAVWYGVVGMVLAG
FT                   GATILSPDVSSLSLILPVILVGAALGAIVARRVQMTEMPQLVAALHSFVGLAAVFIGFN
FT                   AHLQLADVAGMDETTREGLTGFAKVLAHKLADPSGVLVSIMKVEVFLGVFIGAVTFTGS
FT                   VIAFAKLAGKIDGKAMKLPGGHVLNAGCAIASVILLGFYFQSNDLWPLAAMTILALFIG
FT                   YHLIMGIGGADMPVVVSMLNSYSGWAAAAIGFTLGNDLLIVTGALVGSSGAILSYIMCQ
FT                   AMNRSFISVILGGFGSTTAPATEIIGEQVAIDADGVAAALNDADSVVIIPGYGMAVAQA
FT                   QGAVSEVTRKLRSKGKNVRFAIHPVAGRLPGHMNVLLAEAKVPYDIVLEMDEINDDFPE
FT                   TDVAIVIGSNDIVNPAAQEDPNSPISGMPVLECWKAKQVFVSKRGQGTGYSGIENPLFY
FT                   RDNTRMFYGDAKSSLEKLLRLMD"
FT   gene            723018..724892
FT                   /locus_tag="NGR_c06650"
FT   CDS_pept        723018..724892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06650"
FT                   /product="putative methyl-accepting chemotaxis receptor"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06650"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24458"
FT                   /db_xref="GOA:C3MIB0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIB0"
FT                   /protein_id="ACP24458.1"
FT                   /translation="MRDIREFGVALRLSIAFGLLLFAMGVLSLSSIRQVNEINAKLSLI
FT                   NGSNSQKYRNGIDMLGTVRDRAMALRDIVLTDSDTDKATTIAMMKKLQASYASNAAELQ
FT                   KAVNADVFSTAAEHRLVDGLKAFQNEAEPLIAEVIKLTLDGKKDQAKPLLLNQLRPKLT
FT                   AWIGALNKLIDYEQALNQGVGGKVKAASDEFKSLTLTALSVAALFGIFAAALTTRSIIA
FT                   PLAKLQQSVRQMIAGDMQIDRVIERRMDEIGQLARQISSLKTHLSEKAERDAVAEHHRQ
FT                   DAERQRLETEGEERQRAAEQTSSAVEQVAEALKQLSKGNLHIQLDRPFTEALEPLRLDF
FT                   NSAISQLRDAMFEVNYNAQAIAAGAEEIRTSSSELATRTEQQALVVEQTASVLADMTRQ
FT                   VVDASHRAHEAGVLVGETKENVERSGTIMRDAVEAMTKIRASSLEIGDIIGVIDEIASQ
FT                   TNLLALNAGIEAARAGETGRGFAVVAQEVRDLAQRSAAAAKEIKSLVEVSNLHINDGVQ
FT                   RVHQAGDALGQIVVQVQSVNQNVDAIAQVSRTQADGLKDINFSVEKIESATQQNAAMVE
FT                   ESTAAVHNLAKEAASLFEMLSRFQMDDGPADTKRVEESAFSVAVASSA"
FT   gene            complement(724957..725934)
FT                   /locus_tag="NGR_c06660"
FT   CDS_pept        complement(724957..725934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06660"
FT                   /product="putative transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06660"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24459"
FT                   /db_xref="GOA:C3MIB1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR001761"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIB1"
FT                   /protein_id="ACP24459.1"
FT                   /translation="MTTIRDVAKLAGVGVGTASRALTGRGSVSEAARAAVEEAARKLNF
FT                   RPSLTARSLSTGQTGLIGVLTPQFDGVYFGTAVSAAEREIRAAGRHMVVMSTHSDPNLP
FT                   WSEALGLESLAERRVDGILHLSTRHSEKELILAAADGPELAIVNRRINALRHICYSVDH
FT                   YAAGRSVADYLLARGHREFATISGPLDVDDAAERHAGFMDGLAVAGISIDDDLIVQGTF
FT                   HLESGRSAAERLSASAKSFSALFCGNDLMAISAQAYLRQLGQHPEVVGYDNTPLLDFAG
FT                   LKISSVMIPISEMVRNGVLSLLNRCYGESHELIHDFSTQIVERH"
FT   gene            726251..727471
FT                   /locus_tag="NGR_c06670"
FT   CDS_pept        726251..727471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06670"
FT                   /product="sugar ABC transporter, substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06670"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24460"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIB2"
FT                   /protein_id="ACP24460.1"
FT                   /translation="MKRLLCVATAVAMFLPVAVRAEEARVIHWWTSGGESDAIKVIADA
FT                   YKSDGGTWIDQAIAGSDSARLAATNAISGGQPPTMAQFNISNQFRELAEASFLRSLDDV
FT                   AADENWQAVLPGPILDVITVDGHIYAAPVNIHNPAWIWYSTEALQKAQVSEPPTTKNAF
FT                   FTALDKLKSAGIIPLALGGQPWQERATFDAVLLHFGGKDMYMNFIGGNGAALVQTPEFK
FT                   QVLADFKRLKGYVDEGSPNRSWNEATALVIENKAGFQIMGDWAKGEFKAAGDTAGKEYG
FT                   CIVGFGDKPSYMIAGDVFIFPKSNESDTAAQTHLAKLMLSPKVQVDFNNLKGSIPVRAG
FT                   VDGSNMDVCAQAGLAAVSDPSRQVPNPEMRLSPDAHGMVTDAISNFWNTDQSVDEAVAA
FT                   LQSALSM"
FT   gene            727545..728465
FT                   /locus_tag="NGR_c06680"
FT   CDS_pept        727545..728465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06680"
FT                   /product="putative transmembrane component of ABC
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06680"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24461"
FT                   /db_xref="GOA:C3MIB3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIB3"
FT                   /protein_id="ACP24461.1"
FT                   /translation="MKGRSSPTKERSGRLGRGWDLHMPYFALIPLLIVVIVFYLGTMAW
FT                   SVGVSFTSSKLLPTANYVGLEQYRVLFGTARWLVALENIVLFGFTFMASCLVFGFLLAV
FT                   FVDQKVRGEGIFRTIFLFPYAMSFIVTGLVWQWLLNPGLGIQQFVRGLGLEQFTFGWIN
FT                   DQQLAIYAIAIAAFWQGSGLIMVIMLAGLRGVDVELWKAAKIDGVPTWRVYMSIVLPIL
FT                   RPTVATAVVLLALGVVKAYDVVVAMTQGGPGVATEVPAKFIMDYLFQRQNLGLAMAGST
FT                   VMLLSVLMLLAPYLYAQYLRKESRH"
FT   gene            728467..729330
FT                   /locus_tag="NGR_c06690"
FT   CDS_pept        728467..729330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06690"
FT                   /product="hypothetical ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06690"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24462"
FT                   /db_xref="GOA:C3MIB4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIB4"
FT                   /protein_id="ACP24462.1"
FT                   /translation="MAYDNHPPQVRFAIYAVLVVAGIFYFLPIYVMIATSLKSMSEIRD
FT                   GSIFALPAAPSIDAWVRAWTSACTGLNCTGIRVGFWNSVSIVTPSVIVSIFFGALNGYA
FT                   LSFWRPRGGVWLLCGLLLGAFIPYQIFLFPLTKILVAVGLFKTLTGLVFVHTLFGMPIM
FT                   TLLFRNYFASVPSDLFNAARVDGAGFFAIFFFVMLPMATPIVIVAVIMQITAIWNDFLF
FT                   GLVFANSDRVPMTVQLNNIVNSTTGEREYNVNMAATILTSLVPVAVYLLSGKYFVRGIA
FT                   AGAVKG"
FT   gene            729334..730401
FT                   /locus_tag="NGR_c06700"
FT   CDS_pept        729334..730401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06700"
FT                   /product="hypothetical ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06700"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24463"
FT                   /db_xref="GOA:C3MIB5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIB5"
FT                   /protein_id="ACP24463.1"
FT                   /translation="MTKNVSVKKLNIGYGAYTIVKDLDLDIAAGEFLVLLGPSGCGKST
FT                   LLSAFAGLAPVQSGAIHFGDRDVTRLAPKDRGVGMVFQSYALYPTMSVRRNISFGMKMA
FT                   GIRAAERERKVNEVADFLQISALLDRKPSQLSGGQRQRVAIGRALARDADIYLFDEPLS
FT                   NLDAKLRTELRYEIRRLHSELGSTMIYVTHDQIEAMTLATRIAVMKSGVIQQLDRPNEI
FT                   YLRPANLFVAGFVGSPAMNLIKGRIDRAAGGGSIFVSAGFSLELKARYQSQEAILGVRP
FT                   EQFVSRDGPIKGKIEMTEDMGPDALFWLTVGGQRLSIRSSSSSLPQPGSEFSANVDQDV
FT                   ISLFSAESGVRLAAA"
FT   gene            730710..733154
FT                   /locus_tag="NGR_c06710"
FT   CDS_pept        730710..733154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06710"
FT                   /product="beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="gentiobiase; cellobiase; beta-D-glucoside
FT                   glucohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06710"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24464"
FT                   /db_xref="GOA:C3MIB6"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011658"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="InterPro:IPR037524"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIB6"
FT                   /protein_id="ACP24464.1"
FT                   /translation="MIDVKTLLDEMTLAEQVSLLSGDSFWSLPCIQRLGIGTLRLTDGP
FT                   NGARGAGSLIGGVSAAAFPVGIALGATWNPGLMRAVGEALAEEVQSKGAHVSLAPTINI
FT                   QRSVTNGRNFECYSEDPVLTAELAVGFIEGMQAKKVSATVKHFVGNESEIERTTISSDI
FT                   DERTLREVYLVPFEAAVKRAKTWAVMSSYNKLNGTYTAENHWLLTEVLRGDWGFDGVVM
FT                   SDWFGSRSTAPTVNAGLDLEMPGPSRDRGDKLLAAIESGEVSVETIRDCVQNILTLMVR
FT                   TGAIDDHRELKERADDRPEHRALIRRAGAESAVLLQNDGILPLPQQGTVAVIGPNAKAA
FT                   QIMGGGSAQLNPHYTVSPWQGLAGAIGEANLHYAQGCTNHRFEPLIEHPTTFEFFQGRE
FT                   LLGDPVKVVEEPSSLGVWLPPVADGLVDPHHFSARMRTRFTAAEDGIHRIGLTSAGLGR
FT                   VYVDGELVVDAWTCWTRGTTFFEEGCEEVVGEITLEAGRTYEIVAEYVRHDHVNLYIAA
FT                   IRVGIGKVSAEAEISEAAAVAAKADRAVVFVGRTSDWDTEGSDLRDIALPGLQDRLVDA
FT                   VIAANPNTVVVLQTGGPVEMPWLSKARAVLQCWYPGQEAGNAIADVLLGKAEPSGRLAQ
FT                   SFPARWLDNPTQSDDPEVYPGKNGHVRYDEGVFVGYRHYDRAGTKPLFPFGHGLGYTSF
FT                   AIADLTVGTPDGAGSVTVALKLTNTGERAGATVVQIYVSDTEASLPRPVKELKAFAKVA
FT                   LERGESRRVTFTLDARAFAFFDAAERCWRIEGGEFTVMAGLSAGDIRLAATVTQASATM
FT                   PR"
FT   gene            complement(733347..733625)
FT                   /locus_tag="NGR_c06720"
FT   CDS_pept        complement(733347..733625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06720"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06720"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24465"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIB7"
FT                   /protein_id="ACP24465.1"
FT                   /translation="MFEIGAAGSMSGPGTRKRQPKNPVAADEIVSEAIASSKAGGRFRV
FT                   GGTRPSGSDFERGSETGNLALVEAATTAIEAAGGRVASTAEARRIIA"
FT   gene            complement(733637..734464)
FT                   /locus_tag="NGR_c06730"
FT   CDS_pept        complement(733637..734464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NGR_c06730"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c06730"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24466"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR031663"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037161"
FT                   /db_xref="UniProtKB/TrEMBL:C3MIB8"
FT                   /protein_id="ACP24466.1"
FT                   /translation="MTAVALFGAGGKMGCRLTKNLKGSRFDVRHVEVSAGGKARLEREL
FT                   GIGTVDVDQALDGVDVVILAVPDTAIGKVASSIEAKLRPGTMVIALDAAAPAAGHLPDR
FT                   PDLTYFVTHPCHPPIFNDETDPHAKRDFFGGVAAKQHIVSALMQGPEEHYALGEEIAKV
FT                   IWAPVMRSHRVTVEQIALLEPGLSETVCASLLVVMRQAMDECVARGVPKEAARDFLLGH
FT                   LNVLGAVIFEETPGVFSDACNKAIEFGIPALMKDDWKKVFEPKEIADSIRRIT"
FT   gene            complement(735090..735671)
FT                   /locus_tag="NGR_c06740"
FT   CDS_pept        complement(735090..735671)
FT                   /codon_start=1
FT