(data stored in ACNUC7421 zone)

EMBL: CP001389.APAG

CP001389.APAG        Location/Qualifiers
FT   CDS_pept        complement(174671..175063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="NGR_c01540"
FT                   /product="ApaG protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01540"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23956"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MFB9"
FT                   /protein_id="ACP23956.1"
FT                   /translation="MYRALTRDIEVTVEPYYLEEQSDPDDSRYVWGYRIVISNHSEIAV
FT                   RLMTRYWHITDENGQVDEVSGPGVIGEQPLLNPGDTYEYSSGCPLDTPSGVMFGHYSME
FT                   AEDGETFNVAIPAFSLDSPGLVRTLN"
     atgtaccgtg cgctgactcg cgacatagaa gtcacggtgg agccgtacta tctcgaagaa        60
     cagtcagacc cggatgacag ccgctatgtc tggggctacc gcatcgtcat atcgaaccat       120
     tcggagatcg cggttcggct gatgacccgc tattggcaca tcaccgacga gaacggccag       180
     gtcgacgagg tgagcggtcc gggcgtcatc ggcgagcagc cgctgctcaa tcccggcgac       240
     acctacgaat attcctcagg ctgcccgctc gacacgccgt cgggcgtcat gttcggccac       300
     tacagcatgg aggccgaaga cggggagacc ttcaacgtgg cgatccccgc cttttcgctc       360
     gattctcccg gattagtgcg gacgctgaac tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page