(data stored in ACNUC7421 zone)

EMBL: CP001389.ATPF2

CP001389.ATPF2       Location/Qualifiers
FT   CDS_pept        501842..502453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF2"
FT                   /locus_tag="NGR_c04490"
FT                   /product="FoF1 ATP synthase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c04490"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24245"
FT                   /db_xref="GOA:C3MHB7"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHB7"
FT                   /protein_id="ACP24245.1"
FT                   /translation="MTAAYAQQSTTTEGAEAHDAPAAGEVHTETGVAHEAEHGSGVFPP
FT                   FDSSHFASQLLWLAITFGLFYLLMSKVIIPRIGGILEKRHDRIAQDLDEASRLKGEADA
FT                   AIASYEQELANARAKGHSIADTAREEAKSKATADRAAVEAELTKKITAAETRIADIKSK
FT                   ALADVGAIAEETATAVVKQLIGGNVTKTEIAAAVKASAGN"
     gtgaccgcgg cctatgccca gcagtcaacc accactgaag gcgccgaagc acacgatgcc        60
     cctgcggccg gtgaggtgca caccgaaacg ggtgtggccc acgaagccga gcacggttcc       120
     ggcgtgttcc cgcccttcga ttcgtcccat ttcgcgtcgc agctgctttg gctggcgatc       180
     accttcgggc ttttctatct cttgatgtcg aaggtcatca ttccgcgcat cggcgggatt       240
     ctcgaaaagc gccatgaccg gatcgcccag gatctcgatg aagcctcccg cctcaagggc       300
     gaggccgatg ctgcgatcgc ttcctacgag caggaactgg cgaacgccag agccaagggt       360
     cactcgatcg cagatacggc tcgcgaagag gccaagagca aggccactgc cgaccgcgct       420
     gccgtcgaag ccgagctcac taagaagatc accgctgccg aaacgcgcat cgccgatatc       480
     aaatccaagg cacttgccga tgtcggcgcg atcgccgagg agacggcgac ggccgtcgtc       540
     aagcaattga tcggcggaaa cgtcaccaag accgagatcg ccgcggcggt caaggcttcg       600
     gcaggcaact ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page