(data stored in ACNUC7421 zone)

EMBL: CP001389.BIOM

CP001389.BIOM        Location/Qualifiers
FT   CDS_pept        complement(562521..563201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioM"
FT                   /locus_tag="NGR_c05060"
FT                   /product="putative biotin transporter, ATP binding protein
FT                   BioM"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05060"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24302"
FT                   /db_xref="GOA:C3MHH4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHH4"
FT                   /protein_id="ACP24302.1"
FT                   /translation="MDIRLTDCSVRFGERVALHPLTLALDERRIGIIGLNGSGKTTFAR
FT                   LINGLVKPTTGRVTVNGLDTVKDDRAVLAEAGFIFQNPQHQLIMPIVSDDIAFGLKNRG
FT                   LPAHEISSRTEAVLARFAVSHLARRRVHELSGGETQLIAMASVVVTGPKILILDEPTNQ
FT                   LDLRNRRMVAATIDALDEDTIVITHDLGLVEAVERLLLFHEGRLVADGSPGETIRRYHE
FT                   VAGC"
     ttggacatcc gcctcaccga ttgctcggtc cggttcggcg agcgggtagc gcttcatccc        60
     ctgacgcttg ccctcgacga acggcgcatc ggcatcatcg gcctcaacgg ctccggcaag       120
     acgaccttcg cgcggctgat caatggattg gtcaagccga ccacgggacg cgtgacagtc       180
     aacgggctcg atacggtgaa ggacgaccgg gcggtgcttg ccgaggccgg cttcattttc       240
     cagaatccgc agcaccagtt gatcatgccg atcgtttccg acgatattgc cttcggactc       300
     aagaatcgcg gcctgccggc gcacgagatc tcctcgcgaa cggaggcggt gctggcccgg       360
     tttgccgtca gccatctcgc cagacggcgg gtacacgagc tttccggcgg ggagacacag       420
     ctcatcgcca tggccagcgt cgtcgtcacc ggcccgaaaa tcctgatcct cgacgagccg       480
     accaaccagc tcgacctgcg caaccgccgc atggtcgcgg caacgatcga cgcactcgac       540
     gaggatacga tcgtcatcac ccatgacttg gggcttgtcg aagcggtgga acgtctcctg       600
     ctgtttcacg agggccggct tgtcgccgac ggcagccccg gcgaaaccat ccgccgctat       660
     cacgaggtgg ccggatgctg a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page