(data stored in ACNUC7421 zone)

EMBL: CP001389.BION

CP001389.BION        Location/Qualifiers
FT   CDS_pept        complement(561922..562527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioN"
FT                   /locus_tag="NGR_c05050"
FT                   /product="putative biotin transporter, permease protein
FT                   BioN"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05050"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24301"
FT                   /db_xref="GOA:C3MHH3"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHH3"
FT                   /protein_id="ACP24301.1"
FT                   /translation="MLTSLYVEGQSWFHRVPVRLKLIALLVLSVGLFTTNAPLLLLPAF
FT                   LLCGALYLSLGMTARQAFSRVGFVLFTILILAAVNLFLVPFPDVAALVLRLTALVLFAA
FT                   AVTATTTIGAFMDETTILLKPAERLGLLRAADVSLALGLVLRFVPDIFARYQAISEAHR
FT                   ARGLPIRPLTIIGPLIILTLKDADTIAAAIDARGFRRQ"
     atgctgacga gcctctatgt ggaagggcaa agctggtttc accgggtgcc ggtgcgcctg        60
     aagctcattg ctctcctcgt cctcagcgtg ggtcttttta cgacgaacgc gccgcttctg       120
     ctgctgccgg cctttctcct ctgcggcgcc ctctaccttt cgctcggcat gacggcacgc       180
     caggcatttt cgcgggtcgg cttcgtcctg ttcacgatcc ttattctcgc cgcagtcaac       240
     ctcttccttg tccccttccc cgatgtggcc gctctcgtgc tgcggctgac ggccctcgtg       300
     ctgtttgccg ccgccgtcac ggcgacgacg acgatcggcg ccttcatgga cgagaccacc       360
     atcctcctga aaccggcgga gcgtctcggc ctgctgcggg ccgctgacgt cagcctggcg       420
     ctcggcctcg tgctgcgctt cgtcccggat atcttcgccc gatatcaggc gatcagcgag       480
     gcgcaccgcg cccgagggct gccgatccgt ccgttgacga tcatcgggcc gctgatcatc       540
     ctgacgctga aagatgcgga cacgatcgcg gccgccattg acgcgcgcgg atttcgccgc       600
     caataa                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page