(data stored in ACNUC7421 zone)

EMBL: CP001389.CHEA2

CP001389.CHEA2       Location/Qualifiers
FT   CDS_pept        295847..298141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheA2"
FT                   /locus_tag="NGR_c02540"
FT                   /product="Chemotaxis protein CheA"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02540"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24052"
FT                   /db_xref="GOA:C3MG01"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG01"
FT                   /protein_id="ACP24052.1"
FT                   /translation="MDMNEIKEIFFQECEEQLAELESGLLRLNDGDRDPETVNAVFRAV
FT                   HSIKGGAGAFGLDDLVSFAHVFETTLDCVRSNRLEPNQDVLKVMLKSADVLADLTNAAR
FT                   DGGSVDEARSRQLIKELEALANGELPQAAVSEPAAKPAPPAAPVPAPAPAPVVNDEGFQ
FT                   PVAFSFDDFEASEPPAIEPSTFEILFRPKSELYAKGNDATLLLRDLSRLGEMSIHCDMD
FT                   ELPALGSMNPEAAYFAWKISLKTDKGEEAIRSVFEFAEWDCELDVALAGGNAGAGEELP
FT                   MQPVPFDLSLLDGDVSASSGAAEDDEQVVAQREARDEAVSAAATASNVLQMAQTARASA
FT                   ESAKSASPASAAQAAAQQAASAATPTIRVDLDRVDRLINLVGELVINQAMLSQSVIEND
FT                   TNGTSSINMGLEELQQLTREIQDSVMAIRAQPVKPVFQRMSRIVREIADMTGKSVRLVT
FT                   EGENTEVDKTVIDKLAEPLTHMIRNAVDHGLETPEKRVAAGKNPEGTVRLTAKHRSGRI
FT                   VIELADDGAGINREKVRQKAIDNDLIAADANLSDEEIDNLIFHAGFSTADKISDISGRG
FT                   VGMDVVKRSIQALGGRINISSKPGQGSVFTMSLPLTLAVLDGMVVTVANQTLVVPLTAI
FT                   VETLQPEASAIHSFGASQRLISIRNSFCPLVDVGRILNFRAIQANPVDGVALLVESEGG
FT                   GQRALMVDAIQGQRQVVIKSLEANYTHVPGIAAATILGDGRVALILDVDAIVAASRGQT
FT                   LKPEMSLAAAG"
     atggatatga acgaaatcaa agagattttc ttccaggaat gcgaggagca gctcgcggaa        60
     ctggagtcgg gtctcctgag gctcaacgac ggcgaccgcg accccgaaac ggtcaatgct       120
     gtcttccgtg cggtccactc gatcaagggc ggcgccggtg cgttcgggct ggatgacctc       180
     gtctcgttcg cgcatgtgtt cgagacgacg ctcgattgcg ttcgatccaa ccggcttgaa       240
     cccaaccagg atgtgttgaa ggtcatgctg aaatcggcgg atgtgctcgc cgatctcacc       300
     aacgccgcgc gcgacggcgg cagtgtcgac gaggcgcgca gccggcagct gatcaaggaa       360
     cttgaggcgc tcgccaatgg tgaattgccg caggcagccg tttcagaacc ggccgcaaag       420
     ccggcgccgc ccgccgcgcc ggtaccggca cccgcgcccg caccggtcgt caacgatgaa       480
     ggcttccagc ccgttgcctt ctccttcgac gacttcgagg cgagcgagcc tccggcaatc       540
     gagccgtcca cctttgagat cctcttcagg ccgaagtccg aactctatgc caagggcaac       600
     gacgcgacgc tgctgctgcg cgatctctcc cgcctcggcg agatgagcat tcactgcgac       660
     atggacgaac tgccggcgct cggcagcatg aatccggagg ccgcctattt cgcctggaag       720
     atatcgctga agactgacaa gggcgaagag gcgatccgct ccgtgttcga gttcgccgaa       780
     tgggattgcg agctcgacgt ggcgctggcc ggcggcaacg ccggcgccgg cgaggaactg       840
     ccgatgcagc ccgttccgtt cgatctgtcg ctgctcgacg gcgacgtgtc cgcctcgtcg       900
     ggggcggctg aggacgacga gcaggttgtt gcccagcgcg aggcccgcga cgaggccgtc       960
     tcggctgcgg cgaccgccag caatgtcctg cagatggccc agaccgcacg cgcctccgcc      1020
     gagagcgcca agagtgcatc gcctgcctcg gcggcacagg cggctgcgca gcaggccgcg      1080
     tcggcggcca ctccgacgat ccgcgtcgat ctcgaccgcg tcgaccgcct gatcaacctg      1140
     gtcggcgagc tggtgatcaa ccaggcgatg ctgtcgcaga gcgtcatcga gaacgacacg      1200
     aacggcacct cgtcgatcaa catgggcctc gaggagctgc agcagctcac ccgtgagatc      1260
     caggacagcg tcatggcgat ccgcgcgcag ccggtgaagc cggtcttcca gcgcatgtcg      1320
     cgtatcgtcc gtgaaatcgc cgacatgacc ggaaagtcgg tgcgcctcgt caccgagggt      1380
     gagaacacgg aagtcgacaa gacggtcatc gacaagctcg ccgagccgct cacccacatg      1440
     atccgcaatg cggtcgacca cggtctcgaa acgccggaaa agcgcgtcgc cgccggcaag      1500
     aacccggaag gcacggtgcg gctgaccgcc aagcaccgtt ccggccgcat cgtcatcgag      1560
     cttgccgacg acggcgccgg catcaaccgc gagaaggtcc gccagaaggc gatcgacaac      1620
     gatctgatcg ccgccgatgc caatctgtcg gacgaggaaa tcgacaacct gatcttccat      1680
     gcgggcttct cgaccgccga caagatctcc gacatttccg gtcgcggcgt cggcatggac      1740
     gtcgtcaagc gctcgatcca ggcgcttggc ggccgtatca acatctcgtc gaaaccgggg      1800
     cagggctccg tcttcaccat gagcctgccg ctgacgctcg ccgtcctcga cggcatggtg      1860
     gtgacggttg ccaaccagac gctcgtcgtg ccgctgacgg cgatcgtcga aacgctgcag      1920
     ccggaagcct cggcgatcca cagcttcggc gcctcgcagc ggctgatctc gatccgcaac      1980
     tccttctgcc cgctggtcga tgtcggccgc atcctgaact tccgcgccat ccaggccaat      2040
     ccggtcgacg gcgtggccct gctggtcgag tccgaaggcg gcggccagcg cgccctgatg      2100
     gtcgatgcca tccagggcca gcgacaggtg gtgatcaaga gcctcgaggc gaactacacc      2160
     catgtgccgg gcattgcggc ggcgaccatt ctcggcgacg gccgcgtggc gcttattctt      2220
     gatgtcgatg cgatcgttgc cgcctcgcgc ggacaaaccc tgaaacctga aatgtccctt      2280
     gctgcagccg gataa                                                       2295
//

If you have problems or comments...

PBIL Back to PBIL home page