(data stored in ACNUC7421 zone)

EMBL: CP001389.CHEB2

CP001389.CHEB2       Location/Qualifiers
FT   CDS_pept        299515..300567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheB2"
FT                   /locus_tag="NGR_c02570"
FT                   /product="Chemotaxis response regulator protein-glutamate
FT                   methylesterase CheB"
FT                   /EC_number="3.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02570"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24055"
FT                   /db_xref="GOA:C3MG04"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG04"
FT                   /protein_id="ACP24055.1"
FT                   /translation="MNAPARVLVVDDSPTMRGLISAVLNADPEVKVVGQAADALEARQA
FT                   IKQLDPDVVTLDIEMPNMNGLEFLDKIMRLRPMPVIMVSTLTHKGAEATIAALEIGAFD
FT                   CVGKPHPGDPNPFGGLVDKVKAAARSQRKSMITSNRAASAPAVATASDYRAGRKIIAIG
FT                   ASTGGVEALIAVLQKFPANCPPTVITQHMPHTFTKSFSERLNRLCAPTVEEATDGARLE
FT                   VGKVYLAPGGDRHLQIANASAPCCRLVDREPVNGHRPSVDVLFDSVAELAGRNAIGVIL
FT                   TGMGRDGAAGLLKMRHAGARTFGQNEKTCVVYGMPRVAHELGAVEMQLPLGSIGEEILK
FT                   SAAARKEGNE"
     atgaacgctc ccgcccgcgt tctcgttgtc gacgactctc ccaccatgcg tggcctgatc        60
     tcggcggtgc tcaatgccga tccggaggta aaggtcgtcg gccaggcggc cgatgcgctc       120
     gaggcccgtc aggcgatcaa gcagctcgat cccgatgtcg tcaccctcga catcgaaatg       180
     ccgaacatga acggcctcga gttcctcgac aaaatcatgc ggctcaggcc catgccggtc       240
     atcatggtct cgacgctgac ccacaagggc gctgaagcga cgatcgccgc cctcgaaatc       300
     ggtgccttcg attgcgtcgg caagccgcac cccggcgatc cgaacccgtt cggcggcctg       360
     gtcgacaagg tcaaggcggc ggcccgctcg cagcgcaaat cgatgatcac cagcaaccgg       420
     gcggcttccg caccggccgt ggctaccgct tccgactaca gggcgggccg caagatcatc       480
     gcgatcggcg cgtcgaccgg cggcgtggag gcgctgatcg cagtgctgca aaagttcccg       540
     gcgaattgcc cgccaacggt gatcacccag cacatgccgc acacctttac gaagagcttt       600
     tcggaacggt tgaaccgcct ctgcgcgccg accgtcgagg aggcgaccga cggcgcccgc       660
     ctcgaagtcg gcaaggtcta tctggccccc ggcggcgacc ggcacctgca gatcgccaat       720
     gcctctgcgc cgtgctgcag gctggttgac cgggagccgg tcaacgggca tcgcccgtcg       780
     gtcgacgtcc tgttcgattc ggtcgccgaa ctggccgggc gcaatgcgat cggcgtgatc       840
     ctgaccggca tggggcgcga cggcgcggcc ggtctcctca aaatgcggca cgccggggcg       900
     cgcaccttcg gacaaaacga aaagacttgt gtcgtctatg gaatgcccag agtggcccat       960
     gaattgggtg ctgtcgaaat gcagctcccc ctcggatcga tcggggagga gatattgaag      1020
     tcggcagcag cccggaagga aggaaacgaa taa                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page