(data stored in ACNUC7421 zone)

EMBL: CP001389.CHED

CP001389.CHED        Location/Qualifiers
FT   CDS_pept        300953..301507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheD"
FT                   /locus_tag="NGR_c02590"
FT                   /product="predicted chemotaxis protein CheD"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02590"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24057"
FT                   /db_xref="GOA:C3MG06"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MG06"
FT                   /protein_id="ACP24057.1"
FT                   /translation="MMLEAAGRRVHVIQGEFKVVNDPDVVLSTILGSCVAACMRDPVSG
FT                   VGGMNHFLLPGSSTSPASAGDATRYGVHLMELLINGLLKQGARRDRLEAKIFGGAKTIA
FT                   RFSNVGEQNAAFARQFLLDEGIRVVGESTGGEHGRKLEYWPVTGRARQYALTGVEAQRA
FT                   IHQDQRPAPAPKPVESSIEFF"
     atgatgctgg aggctgccgg caggcgtgtg catgtcattc agggcgagtt caaggtcgtc        60
     aacgatccgg atgtcgttct ctcgaccatt ctcggctcct gcgtggctgc ctgcatgcgc       120
     gacccggtgt cgggcgtcgg cggcatgaac cacttcctgc tgccgggctc ttcgacgtcg       180
     ccggcatcgg ccggcgacgc gacgcgctac ggcgtgcatc tcatggaatt gcttatcaac       240
     ggtctcctga aacagggtgc gcgccgcgat cggctcgagg cgaagatttt tggcggagcc       300
     aagacgatcg cacggttctc gaatgtcggc gaacagaacg ccgccttcgc acggcagttc       360
     ctgctcgacg aaggcatccg tgttgtcgga gaaagcaccg gcggcgaaca tggccgcaag       420
     ctggaatatt ggcccgtgac cggccgtgcc cgccaatacg cgctgaccgg tgttgaagcc       480
     cagagggcca tccaccagga tcagcggccc gcgcctgcac cgaagccggt cgaaagctcg       540
     atcgagttct tctga                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page