(data stored in ACNUC7421 zone)

EMBL: CP001389.CHER

CP001389.CHER        Location/Qualifiers
FT   CDS_pept        298610..299518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheR"
FT                   /locus_tag="NGR_c02560"
FT                   /product="Chemotaxis protein methyltransferase, CheR-type"
FT                   /EC_number="2.1.1.80"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02560"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24054"
FT                   /db_xref="GOA:C3MG03"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG03"
FT                   /protein_id="ACP24054.1"
FT                   /translation="MRAQATFEQKLSPDECLAAGEYPLTRRDLGEIAAMIYADAGIYLN
FT                   ESKASLVYSRLSKHIRNLGLKGFRDYCQLVASPAGAAARRDMLSHLTTNFTRFFRENHH
FT                   FEHLKTDVLPGLIARAKNGGRVRIWSAACSDGQEPYSIALTVLSLLPNAADYDFRILAT
FT                   DIDPKILALARAGAYDATALETVSPAMRKQWFREVDVNGRGKWQVDDRVKRLITFNELN
FT                   LMAQWPLKGPFDVIFCRNVVIYFDEPTQMKIWSRFAGVLDTGGHLYIGHSERVSGDAKA
FT                   IFDNIGVTTYRHTGKFHGGRA"
     atgagagccc aagccacttt cgagcagaaa ctgtcgccgg atgaatgcct tgcagccggc        60
     gaatacccgc tgacgcgtcg cgaccttggc gaaatcgccg cgatgatcta cgcggatgcc       120
     gggatctatc tgaatgaatc caaggcgtcg ctggtctatt cgcggctgtc gaaacatatc       180
     cgcaatctcg ggctcaaagg cttccgcgac tattgccagc tcgtcgcctc gccggccggt       240
     gctgcggcgc gccgcgacat gctctcgcat ctgacgacca acttcacccg cttctttcgt       300
     gagaaccatc atttcgagca tctgaagacc gatgtcctgc cgggcctgat cgcccgggcc       360
     aagaacggcg gccgggtccg aatatggtcg gcggcctgtt cggacggcca ggagccctac       420
     tcgattgcgc tgaccgtgct gtcgctgctg ccgaatgcag ccgactacga cttccgcatt       480
     ctcgcgaccg acatcgatcc gaagatcctg gcgctcgccc gggccggcgc ctatgacgcg       540
     acggcgctcg aaacggtcag ccccgccatg cgcaagcaat ggttccgaga ggtcgacgtc       600
     aacggtcgcg gcaagtggca ggtcgatgac cgcgtcaagc ggctgatcac attcaacgag       660
     ctcaatctca tggcgcaatg gccgctcaag gggcccttcg acgtgatctt ctgccgcaac       720
     gtggtgatct atttcgacga gccgacgcag atgaagatct ggtcgcgctt cgcgggcgtg       780
     ctcgataccg gcggtcatct ttatatcggc cactcggagc gcgtctcggg ggatgccaag       840
     gcgatcttcg acaatatcgg cgtcaccacc tatcgccaca ccggaaaatt ccatggaggt       900
     cgggcatga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page