(data stored in ACNUC7421 zone)

EMBL: CP001389.CHEW1

CP001389.CHEW1       Location/Qualifiers
FT   CDS_pept        298146..298613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheW1"
FT                   /locus_tag="NGR_c02550"
FT                   /product="putative CheW family chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c02550"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24053"
FT                   /db_xref="GOA:C3MG02"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:C3MG02"
FT                   /protein_id="ACP24053.1"
FT                   /translation="MTYVAKNLTTGGRELIAFRVGGQEFCVNIMSVREIRGWTPAIAMP
FT                   HAPSYMLGIVNLRGAVLPIIDFSARLGMKAAEPTVRHVIIVAQVKSQVVGLLVDAVSDI
FT                   LTVSDGDIQPTPDIASDFERSFARGVLAIEGRMICLVELDQVFPHEEREAA"
     atgacttatg tcgcaaaaaa tctgacgact ggcggacggg agctgatcgc tttccgcgtc        60
     ggcggccagg aattctgcgt caacatcatg tccgtccgcg agattcgcgg ctggacgcct       120
     gcgatcgcca tgccgcatgc gccgagctat atgctcggga tcgtcaacct gcgcggcgca       180
     gtgctgccga tcatcgattt ttcggcgcgc ctcggcatga aggcggccga gccgacggtg       240
     cgtcacgtca tcatcgtcgc gcaggtgaag agccaggtgg tggggcttct ggtcgatgcc       300
     gtctccgata tcctgaccgt ctcggatggc gacatccagc cgacgccgga tatcgcgtcg       360
     gacttcgaaa gaagctttgc gcgcggcgtc ctggcgatcg agggacggat gatctgcctc       420
     gtcgaactcg accaggtctt cccgcacgag gaaagggaag cagcatga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page