(data stored in ACNUC7421 zone)

EMBL: CP001389.CTAC

CP001389.CTAC        Location/Qualifiers
FT   CDS_pept        579704..580588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaC"
FT                   /locus_tag="NGR_c05230"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05230"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24319"
FT                   /db_xref="GOA:C3MHJ1"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHJ1"
FT                   /protein_id="ACP24319.1"
FT                   /translation="MKNKAYAVLAALACLLFASSAFADKPVDWQTRFQAAATGIMEEIT
FT                   WFEQYTLWFIIPITLLVLLLLIIVVVKFREGANPVPSRTSHNTAIEVIWTVGPVIILLF
FT                   LAIPSFKLLNAQLTPPQNPDLTVKATGNQWYWSYEYEVGENPLSFDSLLLKDEDRASAG
FT                   KEDKAAYPRLLAVDNEVVVPVGKTVRLLVTAADVIHAFAMPAFGVKIDAVPGRLNETWF
FT                   KAAREGLYYGQCSELCGKDHAYMPIAVRVVSQEKYDAWLAAAATNLGEANKALMASIDG
FT                   AAKTVDVAANAAQ"
     gtgaaaaaca aggcctatgc agttctggca gcgcttgcct gtctgctttt tgcttcgagc        60
     gcctttgctg acaagcctgt cgactggcag acacgctttc aggcggctgc gacgggcatc       120
     atggaagaaa tcacgtggtt tgagcaatat accctgtggt tcatcattcc catcacgctc       180
     ctggtcctcc tgctgctgat catcgtcgtc gtgaagttcc gcgagggcgc caatcccgtt       240
     ccttcgcgga ccagccacaa taccgcgatc gaggtcatct ggaccgttgg tccggtcatc       300
     atcctgctgt tcctggccat cccctccttc aagcttctga acgcgcagct cacgccgccg       360
     cagaatccgg acctgacggt caaggcgacc ggcaaccagt ggtactggtc gtacgaatat       420
     gaagtcggcg aaaatccgct gtccttcgat agcctgctcc tgaaggacga ggaccgcgcc       480
     agtgccggca aggaagacaa ggccgcttat ccgcgcctgc tcgccgtcga caacgaagtc       540
     gtggtgccgg tcggcaagac cgttcgtctc ctggtcaccg ccgcagacgt catccatgcc       600
     ttcgccatgc cggccttcgg cgtgaagatc gacgccgttc cgggccgtct caatgaaacc       660
     tggttcaagg cggcccgcga aggcctctac tacggccagt gttccgagct ctgcggcaag       720
     gatcacgcct atatgccgat cgccgtccgc gtggtttcgc aggagaaata cgacgcctgg       780
     ctcgccgccg ccgcaaccaa tctcggcgaa gcgaataagg cgctcatggc gtccatcgac       840
     ggcgcggcca agaccgttga cgtcgccgca aacgccgcac agtaa                       885
//

If you have problems or comments...

PBIL Back to PBIL home page