(data stored in ACNUC7421 zone)

EMBL: CP001389.CTAD

CP001389.CTAD        Location/Qualifiers
FT   CDS_pept        580609..582300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaD"
FT                   /locus_tag="NGR_c05240"
FT                   /product="cytochrome o ubiquinol oxidase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05240"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24320"
FT                   /db_xref="GOA:C3MHJ2"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHJ2"
FT                   /protein_id="ACP24320.1"
FT                   /translation="MAGTAVHHDHRHDHSDHAHDADHAHKPLTFFQRWFLSTNHKDIGT
FT                   LYLIFGIIAGLIGGTLSVFMRAELQEPGIQIFHGLAQMVYGFEGDAAIDGGKHMFNVFT
FT                   TAHALIMIFFMVMPALIGGFANWMVPIMIGAPDMAFPRMNNISFWLIVPAFLLVLLSMF
FT                   VEGPAGAYGAGGGWTIYPPFSTSGMPGPAMDLAILGLHIAGASSILGAINFITTILNMR
FT                   APGMTLHKMPLFAWSVLITAFLLLLSLPVLAGAITMLLTDRNFGTTFFAPEGGGDPILF
FT                   QHLFWFFGHPEVYILILPGFGIVSHIISTFSRKPIFGYLGMAYAMVAIGAVGFIVWAHH
FT                   MYTVGMSLETQRYFVFATMVIAVPTGVKIFSWIATMWGGSIRFTTPMVWAIGFIFLFTV
FT                   GGVTGVQLANAGLDRALHDTYYVVAHFHYVLSLGAVFAIFAAWYYWFPKMSGYMYSEFL
FT                   GKLHFWVMFVGVNLIFFPQHFLGLAGMPRRYIDYPDAFAGWNMVSSYGSYIAAVGVLIF
FT                   LFGVAEAFAKKRVAGDNPWGEGANTLEWQLSSPPPFHQWEQLPRIK"
     atggctggaa cagccgttca tcacgatcac cgccatgatc attccgatca tgcgcatgat        60
     gccgaccacg cccacaagcc gctgaccttc tttcagcgct ggttcctgtc gaccaaccac       120
     aaggacatcg gcacgctcta cctgatcttc gggatcatcg ccggcctcat cggcggtacg       180
     ctgtcggtct tcatgcgcgc cgagctgcag gagccgggca tccagatctt ccacggtctg       240
     gcgcagatgg tctacggctt cgagggcgat gctgccatcg acggcggcaa gcacatgttc       300
     aacgtcttca cgaccgccca cgcactgatc atgatcttct tcatggtcat gccggcgttg       360
     atcggcggtt tcgccaactg gatggtgccg atcatgatcg gcgcgccgga catggccttc       420
     ccgcgcatga acaacatctc gttctggctg atcgtgccgg ccttcctact cgtgctgctt       480
     tcgatgttcg tcgaaggtcc ggcgggtgcc tatggggccg gtggcggctg gacgatctat       540
     ccgccgttct cgacctccgg catgccgggg ccggccatgg atctggcgat cctcggcctg       600
     cacatcgccg gcgcctcgtc gatcctcggc gcgatcaact tcatcacgac gatcctgaac       660
     atgcgcgctc cgggcatgac gctgcacaag atgccgctct ttgcctggtc ggttctgatc       720
     accgccttcc tgctgctgct gtcgctgccg gtcctggctg gcgccatcac catgcttctg       780
     accgaccgca acttcggcac gaccttcttc gcgccggaag gcggcggcga tccgatcctg       840
     ttccagcacc tgttctggtt cttcggtcac ccggaagtgt acatcctgat cctgccgggc       900
     ttcggcatcg tcagccacat tatctcgacc ttctcgcgca agccgatctt cggctatctc       960
     ggcatggcct atgccatggt cgcgatcggc gccgtcggct tcatcgtgtg ggcgcaccac      1020
     atgtacacgg tcggcatgtc gctcgagacg cagcgttact tcgtcttcgc gacgatggtc      1080
     atcgcggttc cgacgggcgt gaagatcttc tcctggatcg cgacgatgtg gggcggttcg      1140
     atccgcttca ccacgccgat ggtctgggcg atcggcttca tcttcctttt caccgtcggc      1200
     ggcgtcacgg gcgttcagct cgccaatgcc ggcctcgacc gcgcgctgca cgacacctac      1260
     tacgtggttg cccacttcca ctacgttctg tcgctcggcg ccgtcttcgc gatcttcgcg      1320
     gcctggtact actggttccc gaagatgagc ggctacatgt attccgaatt tctcggcaag      1380
     ctgcatttct gggtcatgtt cgtcggtgtg aacctgatct tcttcccgca gcacttcctg      1440
     ggtcttgccg gcatgccgcg ccgctacatc gactacccgg atgcctttgc gggctggaac      1500
     atggtatcgt cctacggctc ctacatcgcc gccgtcggcg tgctgatctt cctcttcggc      1560
     gtcgccgaag ccttcgcgaa gaagcgcgtt gcgggcgaca acccgtgggg cgagggcgcc      1620
     aacacgctcg aatggcagct gtcttcgccg ccgccgttcc accagtggga acagctcccg      1680
     cggatcaagt ga                                                          1692
//

If you have problems or comments...

PBIL Back to PBIL home page