(data stored in ACNUC7421 zone)

EMBL: CP001389.CTAE

CP001389.CTAE        Location/Qualifiers
FT   CDS_pept        584171..585049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaE"
FT                   /locus_tag="NGR_c05280"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05280"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24324"
FT                   /db_xref="GOA:C3MHJ6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHJ6"
FT                   /protein_id="ACP24324.1"
FT                   /translation="MAGAHQKNHDYHIIDPSPWPLLASIGAFVMAFGGVGLMRYVAGGS
FT                   FKLFGLELANPWLFLIGLAIVLYTMFGWWSDTIKEGREGHHTRVVSLHLRYGMIMFIAS
FT                   EVMFFAAWFWAFFDASLFAGEPIQAARAAYTGGVWPPKGIEVLDPWHLPLYNTVILLLS
FT                   GTTVTWAHHALLHNDRKGLISGLTLTVLLGVLFSFVQGYEYAHAPFAFRDSIYGATFFM
FT                   ATGFHGFHVLVGTIFLLVCLFRALGGGFSQQHHFGFEAAAWYWHFVDVVWLFLFFSIYI
FT                   WGGWGAPIAHG"
     atggccggag cgcatcagaa gaatcacgac taccacatca tcgatccgag cccgtggccg        60
     ttgctcgcct ccatcggcgc cttcgtcatg gctttcggcg gcgtcggtct catgcgctac       120
     gtggccggcg gctcgttcaa gctgttcggg ctggaacttg ccaatccgtg gctcttcctg       180
     atcggtctgg cgatcgtcct ctacacgatg ttcggctggt ggtcggacac catcaaggag       240
     ggccgcgagg gtcaccacac ccgcgtcgtg tcgctgcacc tgcgctacgg catgatcatg       300
     ttcatcgcct ccgaggtgat gttcttcgcc gcctggttct gggccttctt cgatgccagc       360
     ctgtttgccg gcgagcccat tcaggccgct cgcgccgcct ataccggcgg cgtctggccg       420
     ccgaagggca tcgaggtcct cgatccctgg cacctgccgc tctacaacac ggtcatcctg       480
     ctgctttccg gcacgaccgt gacctgggcg caccatgcgc tcctgcacaa cgaccgcaag       540
     ggcctgatct ccggcctgac gctcaccgtg ctgctcggcg ttctgttctc cttcgtccag       600
     ggctatgaat acgcgcacgc cccgttcgcc ttccgcgatt cgatctatgg cgccaccttc       660
     ttcatggcga ccggcttcca cggcttccac gttctcgtcg gcaccatctt cctgctggtt       720
     tgcctgttcc gggcgctcgg aggcggcttc agccaacagc atcacttcgg cttcgaagcg       780
     gcggcctggt actggcactt cgtcgacgtg gtctggctgt tcctgttctt ctccatctac       840
     atctggggtg gatggggcgc gccgatcgcg cacggctaa                              879
//

If you have problems or comments...

PBIL Back to PBIL home page