(data stored in ACNUC7421 zone)

EMBL: CP001389.CTAG

CP001389.CTAG        Location/Qualifiers
FT   CDS_pept        583509..584108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaG"
FT                   /locus_tag="NGR_c05270"
FT                   /product="cytochrome c oxidase assembly protein CtaG"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05270"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24323"
FT                   /db_xref="GOA:C3MHJ5"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/Swiss-Prot:C3MHJ5"
FT                   /protein_id="ACP24323.1"
FT                   /translation="MTNTPQTPPKERANGVIVGACLAFVAGMVGMAYAAVPLYDMFCRV
FT                   TGYNGTTQRVEQASDVILDEKIKVTFDANVGPGLAWDFKPVQRDIDVRIGETVQVMYRA
FT                   KNLSSKPATGQATFNVTPMAAGAYFNKVQCFCFTETTLQPGEEMEMPVVFFVDPEIVKP
FT                   VETKDIKTLTLSYTFYPREPSKPIAAVKDGETENRL"
     gtgacgaaca ccccgcagac acccccgaag gagcgcgcca acggcgtcat cgtcggcgcc        60
     tgcctcgcct tcgtagcggg catggtcggc atggcctatg ctgccgtgcc gctctatgac       120
     atgttctgcc gggtgacggg ctataacggt acgacgcagc gcgtcgagca ggcctcggac       180
     gtcattctcg acgagaagat caaggtgacc ttcgacgcca atgtcgggcc gggactggca       240
     tgggatttca agccggtcca gcgcgacatc gacgtcagga tcggcgaaac ggtgcaggtc       300
     atgtaccggg cgaagaacct ttcgtcgaag ccggcaaccg gccaggcgac gttcaacgtg       360
     acgccgatgg cggcgggcgc ctatttcaac aaggtgcaat gcttctgctt caccgaaacg       420
     acgctccagc cgggcgagga aatggagatg cccgtcgtct tcttcgtcga tccggagatc       480
     gtcaagccgg tcgagactaa ggacatcaag acgttgacgc tatcctacac cttctatccg       540
     cgcgagccgt ccaagccgat cgccgccgtg aaggacgggg aaactgagaa cagactttga       600
//

If you have problems or comments...

PBIL Back to PBIL home page