(data stored in ACNUC7421 zone)

EMBL: CP001389.DCD

CP001389.DCD         Location/Qualifiers
FT   CDS_pept        177225..178322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="NGR_c01580"
FT                   /product="2'-deoxycytidine 5'-triphosphate deaminase
FT                   protein"
FT                   /EC_number="3.5.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01580"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23959"
FT                   /db_xref="GOA:C3MFC2"
FT                   /db_xref="InterPro:IPR010550"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFC2"
FT                   /protein_id="ACP23959.1"
FT                   /translation="MGRETGILADRAIAALFASGRLKSEKALDDDQIQPASLDLRLGSK
FT                   AFRVRASFMPGPAHLVADKLDRLKLHVIDLSAGAVLETGCVYIVPLMESLSLPEGMSAS
FT                   ANPKSSTGRLDIFTRVITDRAQEFDKIPAGYNGPLYLEISPRTFPIVVRRGSRLSQIRF
FT                   RVGHSVLSEQELLGLHESDVLVASERPNISGGGIALSIDLKGTGPDGLIGYRGKHHTSV
FT                   VDVDKKAEHAVFDFWEPLYSRGRDDLILDPDEFYILVSREAVHVPPLYAAEMTPFDPLV
FT                   GEFRVHYAGFFDPGFGHASAGGSGSRAVLEVRSHEVPFILEHGQIVGRLIYEHMLERPE
FT                   GLYGLDLGSNYQAQGLKLSKHFRAE"
     atgggccggg aaacagggat tttggccgac cgcgcgattg ctgcgctgtt tgcctcggga        60
     cgtctgaaga gcgagaaggc gctggatgat gaccagatcc agccggccag cctcgatctt       120
     cgcctcggat ccaaggcatt tcgcgtccgc gccagcttca tgccggggcc ggcccacctc       180
     gttgccgaca agctcgaccg cctgaagctg catgtcatcg atctcagcgc gggcgcggtt       240
     ctggagacag gctgcgtcta catcgtgccg ctgatggaga gcctttccct gccggagggc       300
     atgtccgcct ccgccaatcc gaagagctcg accggccgcc tcgatatctt cacgcgcgtc       360
     atcaccgacc gggcgcagga gttcgacaag atcccggccg gctataacgg gccgctttac       420
     ctggagatca gccctcggac ctttccgatc gtcgtccgcc gcggttcgcg gctgtcgcag       480
     atccgtttcc gcgtcggtca ctcggttctt tccgaacagg agctgctcgg cctgcacgaa       540
     agcgacgtgc tcgttgccag cgagcggccc aatatcagcg gcggcggcat cgcgctgtcg       600
     atcgacctca aggggaccgg ccccgacggc ctgattggct atcgcggcaa gcaccacacc       660
     tcggtggtcg acgtcgacaa gaaggcggaa cacgcggtct tcgatttctg ggagccgctc       720
     tacagccgcg gacgcgacga cctgatcctc gatccggacg agttctatat cctcgtctcg       780
     cgcgaggcag tgcacgtccc gccgctctac gccgccgaga tgacgccctt cgatccgctg       840
     gtcggcgagt tccgcgtcca ttatgccggt ttcttcgacc cgggtttcgg ccacgcctcg       900
     gccggcggca gcggcagtcg tgccgtgctc gaggtgcgca gccatgaggt gcccttcatc       960
     ctcgaacacg ggcaaatcgt cggccgcctc atctacgagc atatgctgga gcggccggag      1020
     ggcctctacg gtcttgatct cggctcgaac taccaggcgc agggcctcaa gctttcgaag      1080
     cattttcgcg ccgagtga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page