(data stored in ACNUC7421 zone)

EMBL: CP001389.DINF

CP001389.DINF        Location/Qualifiers
FT   CDS_pept        202247..203614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinF"
FT                   /locus_tag="NGR_c01800"
FT                   /product="DNA-damage-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c01800"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23980"
FT                   /db_xref="GOA:C3MFS9"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C3MFS9"
FT                   /protein_id="ACP23980.1"
FT                   /translation="MTAMAGRERERLASEAGPFDVTNRLILSIALPMTLGFLTTPLLGL
FT                   VDTGVVGRLGRAEMLAGLAIGAVLFDLIFTTFNFLRASTTGLVAQAYGRGDRREQQAVF
FT                   WRSLVIALFCGVAIVLLSPLLLSLGLWLMAPEAEVAAVTRTYFLYRMLSGPAALANYAI
FT                   LGFVLGRGEGTLGLLLQTLINGINIVLAILLGLVLGWGVAGVAIATVTGEVAGAVAGFA
FT                   IVYSRFDRRDAPNWATIFAGDRLKALFGLNRDIMIRSFVLLAAFTLMTRIGSSLGPVTL
FT                   AANAVLMTIFLVAGYYLDGLANAAEQLTGRSIGAAYRPGFDRALRMTALWSLGLALLTT
FT                   VFFLAFGNGLVDLLTTAPEVRALAYEFMPWAAVTALTGAMAFLMDGVFIGATWSRDMRN
FT                   MMLAAFVVYGAALTVLVPAFGNHGLWAGLNLFLLLRGLFLVLLLPRRAAQTFRPAQ"
     atgactgcca tggcaggccg cgagcgcgaa aggcttgcct ccgaagcggg gccttttgac        60
     gtcaccaacc ggctgatcct ctcgatcgcc ctgccgatga cgctcgggtt tttgacgacg       120
     ccgcttctcg gcctcgtcga caccggcgtt gtcggccggc tcggccgggc cgagatgctc       180
     gccggcctcg ccatcggcgc cgtcctgttc gatctgatct tcaccacctt caatttcctg       240
     cgcgcctcga ccaccggcct cgtcgctcag gcctatggcc gcggcgaccg gcgcgagcag       300
     caggcggtgt tctggcgctc gctcgtgatc gcgctcttct gtggtgtcgc cattgtcctc       360
     ctgtcgccgc tgctgctctc cctcggtctc tggctgatgg cgccggaggc ggaagtcgcc       420
     gcggtcacgc gcacctattt cctctaccgc atgctgtccg gcccggcggc gctcgccaat       480
     tatgcgatcc tcggcttcgt gcttggccgc ggcgaaggga cgctcggcct gctgctgcag       540
     acgcttatca atggtatcaa catcgtgctg gcgattctgc tcggcctcgt ccttggctgg       600
     ggcgttgccg gtgtcgccat cgctacggtg acgggggagg tggccggcgc ggtggcaggc       660
     ttcgcgatcg tctacagtcg cttcgacaga agggatgcgc cgaactgggc gacgatcttc       720
     gccggcgacc ggctcaaggc cctgtttggc ctcaaccgcg acatcatgat ccggtccttc       780
     gtattgctcg ccgccttcac gctgatgacc cggatcggct cgtccctggg cccggtgacg       840
     ctggcggcca atgccgtgct gatgaccatc ttccttgtcg ccggctatta tctcgacggc       900
     cttgccaatg cggccgagca actgaccggg cgctcgatcg gcgccgccta tcgcccgggc       960
     ttcgatcgtg cgctccggat gaccgcgcta tggtcgctgg ggctcgcgct gctgacgacg      1020
     gtcttcttcc tcgccttcgg caatgggctc gtcgatcttc tgacgacggc gccggaggtg      1080
     cgggcactcg cctatgaatt catgccctgg gcggctgtga cggcactcac cggcgcgatg      1140
     gccttcctga tggacggagt gttcatcggc gccacctggt cgcgcgacat gcgcaacatg      1200
     atgctggcgg ccttcgtcgt ctacggcgcg gcactcaccg ttctcgtgcc ggccttcggc      1260
     aatcacggcc tgtgggccgg tctcaacctg ttcctgctgc tgcgtggcct gttcctggtg      1320
     ctgttgctgc cgcgccgcgc cgctcagacg ttccgcccgg cccagtaa                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page