(data stored in ACNUC7421 zone)

EMBL: CP001389.DNAA

CP001389.DNAA        Location/Qualifiers
FT   CDS_pept        202..1644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="NGR_c00010"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c00010"
FT                   /db_xref="EnsemblGenomes-Tr:ACP23805"
FT                   /db_xref="GOA:C3MEI2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C3MEI2"
FT                   /protein_id="ACP23805.1"
FT                   /translation="MRHDALFERVSARLKAQVGPDVFASWFGRLKLHSVSKSVVRLSVP
FT                   TTFLKSWINNRYLELITSLFQQEDGEILKVEILVRTATRGQRPAVHEEAVAAAAEPAAA
FT                   APVRRAASPQPVAAAAATVAASAKPVQAPLFGSPLDQRYNFESFVEGSSNRVALAAART
FT                   IAEAGAGAVRFNPLFIHSSVGLGKTHLLQAIALAALQSARAPRVVYLTAEYFMWRFATA
FT                   IRDNDALSLKESLRNIDLLVIDDMQFLQGKSIQHEFCHLLNMLLDSAKQVVVAADRAPW
FT                   ELESLDSRVRSRLQGGVAIEMEGPDYDMRLEMLKRRLDTARQDDTSLDIPQEILSHVAR
FT                   SVTASGRELEGAFNQLLFRRSFEPQLSIERVDELLGHLVNAGEPRRVRIEDIQRIVAKH
FT                   YNVSRQELVSNRRTRVIVKPRQIAMYLSKTLTPRSFPEIGRRFGGRDHTTVLHAVRKIE
FT                   ELISGDTKLSHEIELLKRLINE"
     atgcggcatg acgcactttt cgagcgggta agtgcgcgtc taaaagccca ggtcggtccg        60
     gatgtcttcg ccagctggtt cggacgtctc aagctccatt cggtatcgaa aagcgtcgta       120
     cgcctgtcgg tgccgacgac gttcttgaag tcatggatca acaatcgcta tctcgagctg       180
     atcaccagtc ttttccagca ggaagacggt gaaatcctca aggtggagat tctcgtgcgc       240
     accgcgaccc gcggccagcg cccggcggtt cacgaagagg cagttgctgc ggcagccgaa       300
     ccggcggcgg ctgccccggt ccgccgcgca gcctcgcccc agccggtcgc cgctgccgcc       360
     gccacggtcg cagcttcggc aaagccggtg caggcgccgc tgttcggctc gccgctcgac       420
     cagcgctaca atttcgagag cttcgtcgaa ggctcgtcca accgcgtggc gcttgccgcc       480
     gcacgtacga tcgccgaggc cggcgccggc gccgtgcgct tcaatccgct cttcattcat       540
     tcgagcgtcg ggctcggcaa gacgcatctg ctgcaggcga tcgcgcttgc tgccctgcaa       600
     agcgcccggg cgccgcgcgt cgtctacctg acggccgaat atttcatgtg gcgtttcgct       660
     acggcgatcc gtgacaacga cgcgctgtcg ctgaaggaat cgctgcgcaa catcgatctt       720
     ctcgtcatcg acgacatgca gttcctgcag ggaaagtcga tccagcatga gttctgccat       780
     ctcctgaaca tgctgctcga ctcggccaag caggtggtcg tggcggcgga ccgggcgccc       840
     tgggaactgg aatcgctcga cagtcgcgtt cgttcccgcc tgcagggcgg cgtggcgatc       900
     gagatggagg gccccgatta cgacatgcgc ctcgaaatgc tgaagcgccg cctggatacc       960
     gcccgtcagg acgacacctc gctcgacatt ccgcaggaga ttctctccca tgtggcgcga      1020
     agcgtcacgg cgagcggccg cgagctggaa ggggccttca accagctcct gtttcgccgg      1080
     tccttcgagc cgcaactgtc gatagagcgc gtcgacgaac tgctcggaca cctggtcaat      1140
     gccggcgaac cgcgccgcgt ccgcatcgag gatatccagc gcattgtcgc caagcactat      1200
     aatgtgtcgc gccaggaatt ggtttcgaac cgccgaaccc gcgtcatcgt caagccgcgc      1260
     cagatcgcca tgtacctgtc gaagacgctg acgccgcgct ccttcccgga aatcggtcgc      1320
     cgcttcggcg gccgcgatca cacgacggtc ttgcacgcgg tgcgcaagat cgaggagctg      1380
     atctccggcg acacgaaact cagccacgag atcgagctgc tcaagcggct gatcaatgaa      1440
     tag                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page