(data stored in ACNUC7421 zone)

EMBL: CP001389.DNAJ3

CP001389.DNAJ3       Location/Qualifiers
FT   CDS_pept        572856..573908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ3"
FT                   /locus_tag="NGR_c05160"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c05160"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24312"
FT                   /db_xref="GOA:C3MHI4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C3MHI4"
FT                   /protein_id="ACP24312.1"
FT                   /translation="MRDPYAILGVRRSAGQEEIKTAWRSVAKAIHPDHNQDDPLATERF
FT                   AEAGRAYELLRDPARRNRYDQARREAELRRMEAMKEKMRGPEPAEEPVGTESAEEAISR
FT                   IFGVDPQPAPSAGRPKASASRPAEKTGAAAEAKPDTPAETKHEPASTEATVRRLAAPGT
FT                   ELVAAIVRRIRDRITKTAEKVPDLVVDLSVSIDEVIDRARVSLELPDGETVKVAIPPGA
FT                   TDGQVVRLREQGYRVAGMTRGDVVATLRICQDGPFRTRGLDLVTTLPLDLQDAVLGCET
FT                   TIETPNGTATVEVPAWSGSDKVIRIPGKGLNGAYGQYGDLLVELRLVLHEKPDDKVTDL
FT                   MRSQRDGLYL"
     atgcgcgatc cctatgcaat cctcggcgtg cgtcgcagtg ccgggcagga ggaaatcaag        60
     accgcctggc gctccgtcgc caaggcgatc catccggatc acaatcagga cgaccctctg       120
     gcgaccgaac gctttgccga agccggcagg gcttacgaac tgctgcggga tcctgcacgc       180
     aggaaccgct acgaccaggc gcggcgcgag gcggaactgc gacgcatgga agcgatgaag       240
     gaaaagatgc gtggacccga gccggccgag gagccggtcg gcacggagag cgccgaggaa       300
     gcgatctcgc gcatcttcgg cgtcgatccc cagcccgcac cgtccgccgg caggcccaag       360
     gcttccgcat cacgccccgc cgaaaagacc ggtgccgccg ccgaggcgaa accggacaca       420
     ccggccgaga cgaaacacga gccggcaagt acagaggcga ccgtccgacg tctcgcagcg       480
     cccgggacgg aactggtcgc ggcaatcgtt cggcgcatcc gtgatcgcat cacgaaaacg       540
     gcggagaagg tgccggatct cgttgttgat ctttccgtca gtatcgacga ggtcatcgac       600
     cgggcgcgtg tgtccctgga gctcccggat ggcgaaacgg tgaaggtggc aattccgcct       660
     ggcgcgacag acggacaggt cgtccggctg agggaacagg gataccgcgt cgccggcatg       720
     acccggggcg atgtcgtcgc gaccttgcgt atttgccagg acggtccgtt tcgcacccgg       780
     ggcctcgacc tcgtgaccac ccttccgctt gacctccagg atgcggtgct cggctgcgag       840
     acaacgattg aaacgccgaa cggaaccgca acggtcgagg tgccggcgtg gtcgggatcc       900
     gacaaggtca tccgaattcc cggcaaggga ctgaacggcg cctatggcca atacggcgac       960
     ctccttgtcg agttgcgcct ggtgctgcat gaaaagcccg acgacaaggt caccgacctg      1020
     atgcggtcgc agcgtgacgg cctctattta taa                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page