(data stored in ACNUC7421 zone)

EMBL: CP001389.DPPC

CP001389.DPPC        Location/Qualifiers
FT   CDS_pept        396083..396991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppC"
FT                   /locus_tag="NGR_c03480"
FT                   /product="dipeptide ABC transport system permease protein
FT                   DppC"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03480"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24145"
FT                   /db_xref="GOA:C3MGN0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGN0"
FT                   /protein_id="ACP24145.1"
FT                   /translation="MTEVTATSPISTDPSRRARLAEFWYYFSENRGAVIGLFFFLFLVV
FT                   LALCAPLVAPHDPTVQFREAVLLPPFWQEGGRLEFLLGTDAVGRDMLSRLIYGTRFSLF
FT                   VGVIVTTLSLVGGILVGVVAGYFRGWVDTFIMRIMDIILAFPSLLLALVLVAVLGPGLT
FT                   NAMIAIALVFQPHFVRLTRAAVMTEKTRDYVVAAKVAGAGHLRLMFRTILPNCMAPLIV
FT                   QATLSFSSAILDAAALGFLGMGAQPPTPEWGTMLAEAREFILRAWWVVTLPGLAILLTV
FT                   LAINLMGDGLRDALDPKLKRS"
     atgaccgaag ttaccgcaac aagccccata tcgaccgatc cgtcccgccg ggcgcgtctc        60
     gccgagttct ggtactattt ctcggagaac cgcggcgccg tcatcggcct cttcttcttc       120
     ctgttcctgg tcgtacttgc tctatgcgcg ccgctcgtgg caccgcacga cccgaccgtc       180
     cagttccgtg aggcggtatt gctgccgccg ttctggcagg agggtggccg cctcgaattt       240
     ctgctcggaa ccgatgcggt gggccgcgac atgctgtccc gccttatcta cggcacgcgt       300
     ttctcgctgt tcgtcggcgt gatcgtcacc acattgtcgc tggtcggcgg catcctggtc       360
     ggcgttgtcg ccggttactt ccgcggatgg gtcgatacct tcatcatgcg gatcatggat       420
     atcatcctgg ccttcccgtc gctgctcctg gcgcttgtcc tggtcgcggt gctcgggccg       480
     ggcctcacaa atgcgatgat cgccatcgca ctggtcttcc agccgcactt cgttcgcctg       540
     acgcgagcgg ccgtgatgac ggagaagacc cgggactacg tcgtcgcggc gaaggtcgcc       600
     ggagcagggc acctgcggct gatgttcagg acgatcctgc cgaactgcat ggcaccgctc       660
     atcgtccagg cgacgctttc cttttcaagc gccattctcg acgccgcggc gctcggtttc       720
     cttggcatgg gcgcgcaacc gccgacgccg gaatggggaa cgatgctggc ggaggcccgc       780
     gaattcattc ttcgcgcctg gtgggtggtg acgcttccag gtctcgcgat cctgttgacc       840
     gtgctggcaa tcaacctgat gggcgatgga ctgcgtgatg ctctcgaccc caagctgaag       900
     aggtcctga                                                               909
//

If you have problems or comments...

PBIL Back to PBIL home page