(data stored in ACNUC7421 zone)

EMBL: CP001389.DPPD

CP001389.DPPD        Location/Qualifiers
FT   CDS_pept        396993..397847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppD"
FT                   /locus_tag="NGR_c03490"
FT                   /product="dipeptide ABC transporter ATP-binding protein
FT                   DppD"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03490"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24146"
FT                   /db_xref="GOA:C3MGN1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGN1"
FT                   /protein_id="ACP24146.1"
FT                   /translation="MALLEIENLVVEFQTATGPFRAVDGVSLKVHEGEVLAIVGESGSG
FT                   KSVSMLAAMGLLPWTAKVTADKLAFNGRDLLKMPAAERRKIVGKDIAMIFQEPIASLNP
FT                   CFTVGFQIEEVLRIHMGLNRAARRRRAIELFQAVGIPDPAERLGHYPHQMSGGQCQRVM
FT                   IAIALACNPKLLIADEPTTALDVTIQKQILDLLMKLQQEYRMGLIMITHNMGVVAETAD
FT                   RVVVQYKGRKIEEADVLSLFEAPKSNYTRALLAALPENATGDRLPTISELFNEQQTLEG
FT                   AAR"
     atggcgcttc ttgaaatcga aaatctcgtc gtcgaattcc agacggcaac gggccccttc        60
     cgggccgtcg acggcgtatc gctcaaggtt catgagggcg aggtcctggc gatcgtcggg       120
     gagtccggct ccggcaagtc cgtgtccatg cttgcggcga tggggcttct gccctggacc       180
     gcgaaggtga cggccgacaa gctcgccttc aacggccgtg acctcttgaa gatgccggcg       240
     gccgagcgcc gcaagatcgt cggcaaggac attgcgatga tcttccagga gccgatcgcc       300
     agcctcaatc cgtgcttcac ggtcggcttt cagatcgagg aagtgctgcg catccacatg       360
     ggcctcaacc gggcggcgcg gcgcaggcgg gcgatcgagc tcttccaggc cgtcggcata       420
     cccgatccgg ccgagcggct cgggcattat ccgcaccaga tgtcgggcgg gcaatgccag       480
     cgcgtgatga tcgcgatcgc ccttgcctgc aacccgaagc tcctcattgc cgacgagccg       540
     acgacggcgc tcgacgtgac gatccagaag cagatcctcg acctcctgat gaagctgcag       600
     caggaatacc gcatgggcct gatcatgatc acccacaata tgggcgtcgt cgcggaaacg       660
     gccgatcgcg tcgtcgtcca gtacaagggc cgcaagatcg aggaggcgga cgtgttgtcg       720
     ctgttcgagg cgccgaagag caactacacc cgggcgcttc tcgcggcgct gccggaaaat       780
     gcgacgggcg accggttgcc gacgatctcc gaacttttca atgagcagca gacgctcgag       840
     ggagccgctc gatga                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page