(data stored in ACNUC7421 zone)

EMBL: CP001389.DPPF

CP001389.DPPF        Location/Qualifiers
FT   CDS_pept        397844..398671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dppF"
FT                   /locus_tag="NGR_c03500"
FT                   /product="dipeptide ABC transporter ATP-binding protein
FT                   DppF"
FT                   /db_xref="EnsemblGenomes-Gn:NGR_c03500"
FT                   /db_xref="EnsemblGenomes-Tr:ACP24147"
FT                   /db_xref="GOA:C3MGN2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C3MGN2"
FT                   /protein_id="ACP24147.1"
FT                   /translation="MTHVLEARNLVRDYHIPGSLFRKARTVHALKGVSFAVDEGKTLAI
FT                   VGESGCGKSTLGRIITLIDPATAGELLIDGKKVDIARDGLTSEMRRKVQIVFQNPYGSL
FT                   NPRQKIGDILAEPLVINTKVPAGERRDRAMTMLKKVGLEEKHYNRYPHMFSGGQRQRIA
FT                   IARALMLNPKLLVLDEPVSALDLSVQAQVLNLLADLQDEFKLTYVFISHDLSVVRYIAD
FT                   DVMVMYYGEAVEYGSRDEVFSNPQHSYTKTLFAATPRADVASIKARLARRNAA"
     atgacccatg ttctcgaagc ccgcaacctg gtgcgagact atcacattcc cggcagcctg        60
     tttcgcaagg cgcgcaccgt tcatgcgctg aagggcgtca gctttgccgt cgacgagggc       120
     aagacgctgg ctatcgtcgg cgaaagcggc tgcggcaagt cgacgctcgg acgcatcatc       180
     acgctcatcg acccggccac agccggggaa ctgctgatcg atggcaagaa agtcgatatc       240
     gccagggacg gcctgacctc ggagatgcgc cgcaaggtac agatcgtctt ccagaatccc       300
     tacggctccc tcaatccgcg ccagaagatc ggcgatatcc ttgcggaacc gctcgtgatc       360
     aacaccaagg ttcccgccgg cgagcgccgc gaccgggcga tgacgatgct gaagaaggtc       420
     ggcctcgagg agaagcacta caaccgctat cctcacatgt tctcgggcgg ccagcggcag       480
     cgcatcgcca tcgcccgcgc cctgatgctg aacccgaagc tgctcgtgct ggacgaaccc       540
     gtttcggcgc tcgatctctc cgtccaggcc caggtgctga acctgctcgc cgatctgcag       600
     gacgagttca agctgaccta tgtcttcatc agccacgacc tctcggtggt gcgctacatc       660
     gccgacgacg tgatggtgat gtattacggc gaggccgtcg agtatggcag ccgggatgag       720
     gtgttttcca atccgcagca cagctatacg aagacgctgt ttgccgccac gccacgggcc       780
     gatgttgcga gtatcaaggc ccgcctcgcc cgcaggaacg ccgcctag                    828
//

If you have problems or comments...

PBIL Back to PBIL home page